Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GhrA, E.coli (His-SUMO)

GhrA is an enzyme involved in cellular metabolism and plays a crucial role in catalyzing the NADPH-dependent reduction of glyoxylate to glycolate and hydroxypyruvate to glycerate. This enzymatic activity contributes to the conversion of important metabolites and contributes to metabolic pathways related to glyoxylate detoxification and maintenance of cellular homeostasis. GhrA Protein, E.coli (His-SUMO) is the recombinant E. coli-derived GhrA protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

GhrA Protein, E.coli (His-SUMO), E.coli, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ghra-protein-e-coli-his-sumo.html

Smiles

MDIIFYHPTFDTQWWIEALRKAIPQARVRAWKSGDNDSADYALVWHPPVEMLAGRDLKAVFALGAGVDSILSKLQAHPEMLNPSVPLFRLEDTGMGEQMQEYAVSQVLHWFRRFDDYRIQQNSSHWQPLPEYHREDFTIGILGAGVLGSKVAQSLQTWRFPLRCWSRTRKSWPGVQSFAGREELSAFLSQCRVLINLLPNTPETVGIINQQLLEKLPDGAYLLNLARGVHVVEDDLLAALDSGKVKGAMLDVFNREPLPPENPLWQHPRVTITPHVAAITRPAEAVEYISRTIAQLEKGERVCGQVDRARGY

Molecular Formula

/ (Gene_ID) B7LFE3 (M1-Y312) (Accession)

Molecular Weight

Approximately 51.4 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Monoclonal Resistin Antibody (RETN/4326) [Alexa Fluor 405]
NBP3-08258AF405 100 µL

Mouse Monoclonal Resistin Antibody (RETN/4326) [Alexa Fluor 405]

Ask
View Details
Mouse Monoclonal Cytokeratin 19 Antibody (A53-B/A2.26 + BA17) [Alexa Fluor 350]
NBP2-34548AF350 0.1 mL

Mouse Monoclonal Cytokeratin 19 Antibody (A53-B/A2.26 + BA17) [Alexa Fluor 350]

Ask
View Details
Monkey anti-Zona Pellucida Glycoprotein 2 Antibody ELISA Kit
MBS7274854-01 48 Well

Monkey anti-Zona Pellucida Glycoprotein 2 Antibody ELISA Kit

Ask
View Details
Monkey anti-Zona Pellucida Glycoprotein 2 Antibody ELISA Kit
MBS7274854-02 96 Well

Monkey anti-Zona Pellucida Glycoprotein 2 Antibody ELISA Kit

Ask
View Details
Monkey anti-Zona Pellucida Glycoprotein 2 Antibody ELISA Kit
MBS7274854-03 5x 96 Well

Monkey anti-Zona Pellucida Glycoprotein 2 Antibody ELISA Kit

Ask
View Details
Monkey anti-Zona Pellucida Glycoprotein 2 Antibody ELISA Kit
MBS7274854-04 10x 96 Well

Monkey anti-Zona Pellucida Glycoprotein 2 Antibody ELISA Kit

Ask
View Details