Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GhrA, E.coli (His-SUMO)

GhrA is an enzyme involved in cellular metabolism and plays a crucial role in catalyzing the NADPH-dependent reduction of glyoxylate to glycolate and hydroxypyruvate to glycerate. This enzymatic activity contributes to the conversion of important metabolites and contributes to metabolic pathways related to glyoxylate detoxification and maintenance of cellular homeostasis. GhrA Protein, E.coli (His-SUMO) is the recombinant E. coli-derived GhrA protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

GhrA Protein, E.coli (His-SUMO), E.coli, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ghra-protein-e-coli-his-sumo.html

Smiles

MDIIFYHPTFDTQWWIEALRKAIPQARVRAWKSGDNDSADYALVWHPPVEMLAGRDLKAVFALGAGVDSILSKLQAHPEMLNPSVPLFRLEDTGMGEQMQEYAVSQVLHWFRRFDDYRIQQNSSHWQPLPEYHREDFTIGILGAGVLGSKVAQSLQTWRFPLRCWSRTRKSWPGVQSFAGREELSAFLSQCRVLINLLPNTPETVGIINQQLLEKLPDGAYLLNLARGVHVVEDDLLAALDSGKVKGAMLDVFNREPLPPENPLWQHPRVTITPHVAAITRPAEAVEYISRTIAQLEKGERVCGQVDRARGY

Molecular Formula

/ (Gene_ID) B7LFE3 (M1-Y312) (Accession)

Molecular Weight

Approximately 51.4 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

TMEM120A (NM_031925) Human Tagged ORF Clone Lentiviral Particle
RC208685L4V 200 µL

TMEM120A (NM_031925) Human Tagged ORF Clone Lentiviral Particle

Ask
View Details
Lentiviral mouse Ltk shRNA (UAS) - Lentiviral mouse Ltk shRNA (UAS, iRFP) (100)
GTR15243087 1 Vial

Lentiviral mouse Ltk shRNA (UAS) - Lentiviral mouse Ltk shRNA (UAS, iRFP) (100)

Ask
View Details
Human HOXC12 Pre-designed siRNA Set A
SI007216A 1 Each

Human HOXC12 Pre-designed siRNA Set A

Ask
View Details
Recombinant CCL3 (MIP-1alpha), biotinylated
MBS191496-01 0.002 mg

Recombinant CCL3 (MIP-1alpha), biotinylated

Ask
View Details
Recombinant CCL3 (MIP-1alpha), biotinylated
MBS191496-02 0.01 mg

Recombinant CCL3 (MIP-1alpha), biotinylated

Ask
View Details
Recombinant CCL3 (MIP-1alpha), biotinylated
MBS191496-03 0.05 mg

Recombinant CCL3 (MIP-1alpha), biotinylated

Ask
View Details