Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Betacellulin/BTC, Mouse (N-His)

Probetacellulin Protein, Mouse, induces differentiation of pancreatic β-cells and promotes regeneration of β-cells in experimental diabetes.

Product Specifications

Product Name Alternative

Betacellulin/BTC Protein, Mouse (N-His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/probetacellulin-protein-mouse.html

Purity

98.0

Smiles

DGNTTRTPETNGSLCGAPGENCTGTTPRQKVKTHFSRCPKQYKHYCIHGRCRFVVDEQTPSCICEKGYFGARCERVDLFY

Molecular Formula

12223 (Gene_ID) Q05928 (D32-Y111) (Accession)

Molecular Weight

Approximately 12-15 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Li L, et al. Betacellulin improves glucose metabolism by promoting conversion of intraislet precursor cells to beta-cells in streptozotocin-treated mice. Am J Physiol Endocrinol Metab. 2003 Sep;285 (3) :E577-83.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GluR23Y
HY-P5487 1 Each

GluR23Y

Sign In for Pricing
View Details
Bloc1s5 (NM_001107347) Rat Tagged ORF Clone Lentiviral Particle
RR208198L3V 200 µL

Bloc1s5 (NM_001107347) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
TBX18 (T-Box 18) (FITC)
MBS6176004-01 0.1 mL

TBX18 (T-Box 18) (FITC)

Sign In for Pricing
View Details
TBX18 (T-Box 18) (FITC)
MBS6176004-02 5x 0.1 mL

TBX18 (T-Box 18) (FITC)

Sign In for Pricing
View Details
Human Papillomavirus L1 protein (HPVL1), recombinant, type 18
MBS663030-01 0.1 mg

Human Papillomavirus L1 protein (HPVL1), recombinant, type 18

Sign In for Pricing
View Details
Human Papillomavirus L1 protein (HPVL1), recombinant, type 18
MBS663030-02 0.5 mg

Human Papillomavirus L1 protein (HPVL1), recombinant, type 18

Sign In for Pricing
View Details