Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Betacellulin/BTC, Mouse (N-His)

Probetacellulin Protein, Mouse, induces differentiation of pancreatic β-cells and promotes regeneration of β-cells in experimental diabetes.

Product Specifications

Product Name Alternative

Betacellulin/BTC Protein, Mouse (N-His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/probetacellulin-protein-mouse.html

Purity

98.0

Smiles

DGNTTRTPETNGSLCGAPGENCTGTTPRQKVKTHFSRCPKQYKHYCIHGRCRFVVDEQTPSCICEKGYFGARCERVDLFY

Molecular Formula

12223 (Gene_ID) Q05928 (D32-Y111) (Accession)

Molecular Weight

Approximately 12-15 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Li L, et al. Betacellulin improves glucose metabolism by promoting conversion of intraislet precursor cells to beta-cells in streptozotocin-treated mice. Am J Physiol Endocrinol Metab. 2003 Sep;285 (3) :E577-83.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

STK31, CT (Serine/Threonine-protein Kinase 31, Serine/Threonine-protein Kinase NYD-SPK, SgK396, SGK396, Sugen Kinase 396) (MaxLight 650)
MBS6500202-01 0.1 mL

STK31, CT (Serine/Threonine-protein Kinase 31, Serine/Threonine-protein Kinase NYD-SPK, SgK396, SGK396, Sugen Kinase 396) (MaxLight 650)

Ask
View Details
STK31, CT (Serine/Threonine-protein Kinase 31, Serine/Threonine-protein Kinase NYD-SPK, SgK396, SGK396, Sugen Kinase 396) (MaxLight 650)
MBS6500202-02 5x 0.1 mL

STK31, CT (Serine/Threonine-protein Kinase 31, Serine/Threonine-protein Kinase NYD-SPK, SgK396, SGK396, Sugen Kinase 396) (MaxLight 650)

Ask
View Details
CARD11 Peptide
DF7613-BP 1 mg

CARD11 Peptide

Ask
View Details
GENLISA™ Mouse Apolipoprotein A5 (APOA5) ELISA
KLM5148 1x 96 Well

GENLISA™ Mouse Apolipoprotein A5 (APOA5) ELISA

Ask
View Details
Lentiviral human C8orf74 sgRNA gene knockout kit - Lentiviral human C8orf74 sgRNA gene knockout kit (100)
GTR15378346 1 Vial

Lentiviral human C8orf74 sgRNA gene knockout kit - Lentiviral human C8orf74 sgRNA gene knockout kit (100)

Ask
View Details