Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Betacellulin/BTC, Mouse (N-His)

Probetacellulin Protein, Mouse, induces differentiation of pancreatic β-cells and promotes regeneration of β-cells in experimental diabetes.

Product Specifications

Product Name Alternative

Betacellulin/BTC Protein, Mouse (N-His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/probetacellulin-protein-mouse.html

Purity

98.0

Smiles

DGNTTRTPETNGSLCGAPGENCTGTTPRQKVKTHFSRCPKQYKHYCIHGRCRFVVDEQTPSCICEKGYFGARCERVDLFY

Molecular Formula

12223 (Gene_ID) Q05928 (D32-Y111) (Accession)

Molecular Weight

Approximately 12-15 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Li L, et al. Betacellulin improves glucose metabolism by promoting conversion of intraislet precursor cells to beta-cells in streptozotocin-treated mice. Am J Physiol Endocrinol Metab. 2003 Sep;285 (3) :E577-83.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human F13B ELISA Kit
E009875-01 1 Each

Human F13B ELISA Kit

Sign In for Pricing
View Details
Human F13B ELISA Kit
E009875-02 1 Each

Human F13B ELISA Kit

Sign In for Pricing
View Details
Mouse Cyp1a2/Cytochrome P450 1A2 ELISA Kit
E0372Mo 96 Tests

Mouse Cyp1a2/Cytochrome P450 1A2 ELISA Kit

Sign In for Pricing
View Details
PROX1 (C-term) Rabbit Polyclonal Antibody
DP3501 200 µL

PROX1 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Brilliant Violet 421™ anti-human CX3CR1
GT11627 25 Tests

Brilliant Violet 421™ anti-human CX3CR1

Sign In for Pricing
View Details
Protein S100-A1 (S100 calcium-binding protein A1 S-100 protein alpha subunit, S-100 protein alpha chain, Roundabout homolog 1, S100A1, S100A)
MBS606438-01 0.1 mg

Protein S100-A1 (S100 calcium-binding protein A1 S-100 protein alpha subunit, S-100 protein alpha chain, Roundabout homolog 1, S100A1, S100A)

Sign In for Pricing
View Details