Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GLP1R, Human (HEK293, Fc)

The GLP1R protein is a G protein-coupled receptor for glucagon-like peptide 1 (GLP-1), which upon ligand binding activates adenylyl cyclase and increases cAMP levels. This interaction critically regulates insulin secretion, affecting cellular responses and metabolic processes associated with GLP-1 signaling. GLP1R Protein, Human (HEK293, Fc) is the recombinant human-derived GLP1R protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

GLP1R Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/glp1r-protein-human-hek-293-fc.html

Purity

98.0

Smiles

RPQGATVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYACWPDGEPGSFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPWRDLSECEESKRGERSSPEEQLLFLY

Molecular Formula

2740 (Gene_ID) P43220 (R24-Y145) (Accession)

Molecular Weight

50-70 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MLXIPL Antibody - N-terminal region : HRP (ARP39736_T100-HRP)
ARP39736_T100-HRP 100 µL

MLXIPL Antibody - N-terminal region : HRP (ARP39736_T100-HRP)

Sign In for Pricing
View Details
CD34 Monoclonal Antibody
MBS9524764-01 0.05 mL

CD34 Monoclonal Antibody

Sign In for Pricing
View Details
CD34 Monoclonal Antibody
MBS9524764-02 0.1 mL

CD34 Monoclonal Antibody

Sign In for Pricing
View Details
CD34 Monoclonal Antibody
MBS9524764-03 0.2 mL

CD34 Monoclonal Antibody

Sign In for Pricing
View Details
CD34 Monoclonal Antibody
MBS9524764-04 5x 0.2 mL

CD34 Monoclonal Antibody

Sign In for Pricing
View Details
KLF16, Control Peptide (Kruppel-like Factor 16, Basic Transcription Element Binding Protein 4, BTE-binding Protein 4, BTEB4, DRRF, Novel Sp1-like Zinc Finger Transcription Factor 2, NSLP2, Transcription Factor BTEB4, Transcription Factor NSLP2)
148113 100 µg

KLF16, Control Peptide (Kruppel-like Factor 16, Basic Transcription Element Binding Protein 4, BTE-binding Protein 4, BTEB4, DRRF, Novel Sp1-like Zinc Finger Transcription Factor 2, NSLP2, Transcription Factor BTEB4, Transcription Factor NSLP2)

Sign In for Pricing
View Details