Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-19, Mouse

IL-19 Protein, Mouse is a member of the Interleukin-10 family. The biological functions and clinical implications of Interleukin-19 is still undefined.

Product Specifications

Product Name Alternative

IL-19 Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-19-protein-mouse.html

Purity

97.00

Smiles

LRRCLISVDMRLIEKSFHEIKRAMQTKDTFKNVTILSLENLRSIKPGDVCCMTNNLLTFYRDRVFQDHQERSLEVLRRISSIANSFLCVQKSLERCQVHRQCNCSQEATNATRIIHDNYNQLEVSSAALKSLGELNILLAWIDRNHLETPAA

Molecular Formula

329244 (Gene_ID) Q8CJ70 (L25-A176) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1][2]

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Human Extracellular calcium-sensing receptor polyclonal Antibody, HRP conjugated
MBS1489044-01 0.05 mg

Rabbit anti-Human Extracellular calcium-sensing receptor polyclonal Antibody, HRP conjugated

Sign In for Pricing
View Details
Rabbit anti-Human Extracellular calcium-sensing receptor polyclonal Antibody, HRP conjugated
MBS1489044-02 0.1 mg

Rabbit anti-Human Extracellular calcium-sensing receptor polyclonal Antibody, HRP conjugated

Sign In for Pricing
View Details
Rabbit anti-Human Extracellular calcium-sensing receptor polyclonal Antibody, HRP conjugated
MBS1489044-03 5x 0.1 mg

Rabbit anti-Human Extracellular calcium-sensing receptor polyclonal Antibody, HRP conjugated

Sign In for Pricing
View Details
Phospholipase A2
P4074 1 mg

Phospholipase A2

Sign In for Pricing
View Details
SUMO2P4 Protein Vector (Human) (pPB-N-His)
PV134187 500 ng

SUMO2P4 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Synaptopodin Rabbit Polyclonal Antibody
orb411891-01 30 µL

Synaptopodin Rabbit Polyclonal Antibody

Sign In for Pricing
View Details