Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Epididymal-specific lipocalin-10 (Lcn10), partial

Product Specifications

Abbreviation

Recombinant Mouse Lcn10 protein, partial

Gene Name

Lcn10

UniProt

Q810Z1

Expression Region

20-135aa

Organism

Mus musculus (Mouse)

Target Sequence

QEFFPKEAQTLNWSKFSGFWYIIAIATDTQGFLPARDKRKLGASVVKVHKTGQLRVVIAFSRPRGCQSREVTLKKDRKRPVFRNTLKGVKGFHVLSTDYTYGLVYLRLGRGGSNYK

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cell Biology

Relevance

May play a role in male fertility. May act as a retinoid carrier protein within the epididymis.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

19.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse RRP36 Protein, His (Fc)-Avi-tagged
RRP36-7819M 50 µg

Recombinant Mouse RRP36 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Rho GTPase Activating Protein 25 (ARHGAP25) Antibody
abx230551 100 µg

Rho GTPase Activating Protein 25 (ARHGAP25) Antibody

Sign In for Pricing
View Details
Ptov1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K7447305 3x 1.0 µg

Ptov1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) YAR1 Polyclonal Antibody
MBS7145897 Inquire

Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) YAR1 Polyclonal Antibody

Sign In for Pricing
View Details
Glutamate Receptor, Ionotropic kainate 2 (GRIK2) Mouse ELISA Kit
D7269 96 Tests

Glutamate Receptor, Ionotropic kainate 2 (GRIK2) Mouse ELISA Kit

Sign In for Pricing
View Details
Influenza A (A/Hong kong/213/2003) HA Protein (HA1 Subunit) (28 Ser/Trp), His Tag
VAG114 50 µg

Influenza A (A/Hong kong/213/2003) HA Protein (HA1 Subunit) (28 Ser/Trp), His Tag

Sign In for Pricing
View Details