Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Epididymal-specific lipocalin-10 (Lcn10), partial

Product Specifications

Abbreviation

Recombinant Mouse Lcn10 protein, partial

Gene Name

Lcn10

UniProt

Q810Z1

Expression Region

20-135aa

Organism

Mus musculus (Mouse)

Target Sequence

QEFFPKEAQTLNWSKFSGFWYIIAIATDTQGFLPARDKRKLGASVVKVHKTGQLRVVIAFSRPRGCQSREVTLKKDRKRPVFRNTLKGVKGFHVLSTDYTYGLVYLRLGRGGSNYK

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cell Biology

Relevance

May play a role in male fertility. May act as a retinoid carrier protein within the epididymis.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

19.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Magic™ Membrane Protein Human NPDC1 (Neural proliferation, differentiation and control 1) for Antibody Discovery
MP0541J Each

Magic™ Membrane Protein Human NPDC1 (Neural proliferation, differentiation and control 1) for Antibody Discovery

Sign In for Pricing
View Details
OR4F3 (OR4F16) (NM_001005277) Human Tagged ORF Clone Lentiviral Particle
RC212774L3V 200 µL

OR4F3 (OR4F16) (NM_001005277) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Mouse Monoclonal GSTT2 Antibody (OTI3B6) [mFluor Violet 610 SE]
NBP2-70861MFV610 0.1 mL

Mouse Monoclonal GSTT2 Antibody (OTI3B6) [mFluor Violet 610 SE]

Sign In for Pricing
View Details
Anti-Human NDUFS6 Polyclonal Antibody
PHB17801 100 μg

Anti-Human NDUFS6 Polyclonal Antibody

Sign In for Pricing
View Details
Human KLHL28 Knockout HEK293T cell line
GTR15411302 1 Vial

Human KLHL28 Knockout HEK293T cell line

Sign In for Pricing
View Details
Tfe3 Mouse Pre-designed siRNA Set A
HY-RS19388 1 Set

Tfe3 Mouse Pre-designed siRNA Set A

Sign In for Pricing
View Details