Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Epididymal-specific lipocalin-10 (Lcn10), partial

Product Specifications

Abbreviation

Recombinant Mouse Lcn10 protein, partial

Gene Name

Lcn10

UniProt

Q810Z1

Expression Region

20-135aa

Organism

Mus musculus (Mouse)

Target Sequence

QEFFPKEAQTLNWSKFSGFWYIIAIATDTQGFLPARDKRKLGASVVKVHKTGQLRVVIAFSRPRGCQSREVTLKKDRKRPVFRNTLKGVKGFHVLSTDYTYGLVYLRLGRGGSNYK

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cell Biology

Relevance

May play a role in male fertility. May act as a retinoid carrier protein within the epididymis.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

19.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ID4, NT (ID4, BHLHB27, DNA-binding protein inhibitor ID-4, Class B basic helix-loop-helix protein 27, Inhibitor of DNA binding 4) (MaxLight 650) discontinued
036866-ML650 100 µL

ID4, NT (ID4, BHLHB27, DNA-binding protein inhibitor ID-4, Class B basic helix-loop-helix protein 27, Inhibitor of DNA binding 4) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Ptpn2 (NM_053990) Rat Tagged ORF Clone Lentiviral Particle
RR209781L3V 200 µL

Ptpn2 (NM_053990) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
NKX2.1 Antibody / TTF-1
V5549-100UG 100 µg

NKX2.1 Antibody / TTF-1

Sign In for Pricing
View Details
Destrin (DSTN) Antibody
abx034267-01 80 µL

Destrin (DSTN) Antibody

Sign In for Pricing
View Details
Destrin (DSTN) Antibody
abx034267-02 400 µL

Destrin (DSTN) Antibody

Sign In for Pricing
View Details
Prelid3a (NM_144867) Mouse Tagged ORF Clone
MR201454 10 µg

Prelid3a (NM_144867) Mouse Tagged ORF Clone

Sign In for Pricing
View Details