Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Epididymal-specific lipocalin-10 (Lcn10), partial

Product Specifications

Abbreviation

Recombinant Mouse Lcn10 protein, partial

Gene Name

Lcn10

UniProt

Q810Z1

Expression Region

20-135aa

Organism

Mus musculus (Mouse)

Target Sequence

QEFFPKEAQTLNWSKFSGFWYIIAIATDTQGFLPARDKRKLGASVVKVHKTGQLRVVIAFSRPRGCQSREVTLKKDRKRPVFRNTLKGVKGFHVLSTDYTYGLVYLRLGRGGSNYK

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cell Biology

Relevance

May play a role in male fertility. May act as a retinoid carrier protein within the epididymis.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

19.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF295-AS1 ORF Vector (Human) (pORF)
51422011 1.0 µg DNA

ZNF295-AS1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
EP300 (Histone Acetyltransferase p300, p300 HAT, E1A-associated Protein p300, P300)
126355 50 µg

EP300 (Histone Acetyltransferase p300, p300 HAT, E1A-associated Protein p300, P300)

Sign In for Pricing
View Details
Msmp 3'UTR Luciferase Stable Cell Line
TU113528 1.0 mL

Msmp 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Recombinant Myxoma virus Serine proteinase inhibitor 2 (SERP2)
MBS1010274-01 0.02 mg (E-Coli)

Recombinant Myxoma virus Serine proteinase inhibitor 2 (SERP2)

Sign In for Pricing
View Details
Recombinant Myxoma virus Serine proteinase inhibitor 2 (SERP2)
MBS1010274-02 0.02 mg (Yeast)

Recombinant Myxoma virus Serine proteinase inhibitor 2 (SERP2)

Sign In for Pricing
View Details
Recombinant Myxoma virus Serine proteinase inhibitor 2 (SERP2)
MBS1010274-03 0.1 mg (E-Coli)

Recombinant Myxoma virus Serine proteinase inhibitor 2 (SERP2)

Sign In for Pricing
View Details