Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Histone H4, Human/Xenopus laevis

Histone H4 proteins are core components of nucleosomes, which compact DNA into chromatin and regulate DNA accessibility during cellular processes. Histones, including H4, play critical roles in transcriptional regulation, DNA repair, replication, and chromosome stability. Histone H4 Protein, Human/Xenopus laevis is the recombinant Xenopus laevis-derived Histone H4 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

Histone H4 Protein, Human/Xenopus laevis, Xenopus laevis; Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/histone-h4-protein-human-xenopus-laevis.html

Purity

95.00

Smiles

SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG

Molecular Formula

121504 (Gene_ID) P62805 (S2-G103) (Accession)

Molecular Weight

Approximately 11 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

REPIN1 Protein Vector (Mouse) (pPM-C-HA)
PV223484 500 ng

REPIN1 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
NCKIPSD 3'UTR Lenti-reporter-Luc Vector
31562081 1.0 µg

NCKIPSD 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
RNU4-10P Recombinant Protein (Human)
RP088875 100 µg

RNU4-10P Recombinant Protein (Human)

Sign In for Pricing
View Details
POLR3K Antibody
orb1559270-01 50 µL

POLR3K Antibody

Sign In for Pricing
View Details
POLR3K Antibody
orb1559270-02 100 µL

POLR3K Antibody

Sign In for Pricing
View Details
POLR3K Antibody
orb1559270-03 200 µL

POLR3K Antibody

Sign In for Pricing
View Details