Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSMA, Human (HEK293, His)

PSMA protein, with a preference for tri-alpha-glutamate peptides, acts as a folate hydrolase and NAALADase enzyme. It uptakes folate in the intestines, modulates excitatory neurotransmission by hydrolyzing NAAG to release glutamate in the brain, and exhibits dipeptidyl-peptidase IV type activity by cleaving Gly-Pro-AMC in vitro. PSMA Protein, Human (HEK293, His) is the recombinant human-derived PSMA protein, expressed by HEK293 , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

PSMA Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/psma-protein-human-hek293-n-his.html

Purity

95.49

Smiles

KSSNEATNITPKHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA

Molecular Formula

2346 (Gene_ID) Q04609-1 (K44-A750) (Accession)

Molecular Weight

80-120 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CSF1R Antibody
OAAN01017-200UL 200 µL

CSF1R Antibody

Sign In for Pricing
View Details
Lu AF21934 10mg
A12140-10 10 mg

Lu AF21934 10mg

Sign In for Pricing
View Details
AMPK beta 1/PRKAB1 Polyclonal Antibody, APC-Cy5.5 Conjugated
bs-20237R-APC-Cy5.5 100 µL

AMPK beta 1/PRKAB1 Polyclonal Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details
KPNA6 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV627477 1.0 µg DNA

KPNA6 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
6-Azaspiro[3.5]nonan-8-ol
SID80531-01 50 mg

6-Azaspiro[3.5]nonan-8-ol

Sign In for Pricing
View Details
6-Azaspiro[3.5]nonan-8-ol
SID80531-02 0.5 g

6-Azaspiro[3.5]nonan-8-ol

Sign In for Pricing
View Details