Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Kras4B, Human (G13C, His)

KRAS protein is a key Ras family member that binds GDP/GTP and has intrinsic GTPase activity. Its critical role in regulating cell proliferation emphasizes its importance in cellular processes. Kras4B Protein, Human (G13C, His) is the recombinant human-derived KRAS protein, expressed by E. coli , with N-6*His labeled tag and G13C mutation.

Product Specifications

Product Name Alternative

Kras4B Protein, Human (G13C, His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/kras-protein-human-g13c-his.html

Purity

95.0

Smiles

TEYKLVVVGAGCVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEKMSKDGKKKKKKSKTKC

Molecular Formula

3845 (Gene_ID) AAH13572.1 (T2-C185, G13C) (Accession)

Molecular Weight

Approximately 25 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

pExpress-1-Gimap7 Plasmid
PVT39385 2 µg

pExpress-1-Gimap7 Plasmid

Sign In for Pricing
View Details
Tssc4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K6586607 1.0 µg DNA

Tssc4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
HAND1 (phospho Ser98) Antibody
A1034-01 50 μL

HAND1 (phospho Ser98) Antibody

Sign In for Pricing
View Details
HAND1 (phospho Ser98) Antibody
A1034-02 100 µL

HAND1 (phospho Ser98) Antibody

Sign In for Pricing
View Details
Rat CXC-chemokine ligand 16,CXCL16 ELISA Kit
CN-01429R2 48T

Rat CXC-chemokine ligand 16,CXCL16 ELISA Kit

Sign In for Pricing
View Details
Recombinant Rat PRSS35 Protein, His (Fc)-Avi-tagged
PRSS35-4403R 50 µg

Recombinant Rat PRSS35 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details