Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-33, Canine

IL-33 Protein activates NF-kappa-B and MAPK signaling, inducing Th2 cell maturation and cytokine secretion. It activates mast cells, basophils, eosinophils, and natural killer cells, acting as a chemoattractant for Th2 cells. IL-33 preserves Krebs cycle integrity, reducing reactive oxygen species production. In quiescent endothelial cells, IL-33 acts as a transcriptional repressor, but is lost upon angiogenic or pro-inflammatory activation. IL-33 Protein, Canine is the recombinant canine-derived IL-33 protein, expressed by E. coli , with N-Met labeled tag.

Product Specifications

Product Name Alternative

IL-33 Protein, Canine, Canine, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-33-protein-canine.html

Purity

95.50

Smiles

SIQEYSASLSTYNDQSITFVFEDGSYEIYVEDLRKGQEKDKVLFRYYDSQSPSHETGDDVDGQTLLVNLSPTKDKDFLLHANNEEHSVELQKCENQLPDQAFFLLHRKSSECVSFECKNNPGVFIGVKDNHLALIKVGDQTKDSYIEKTIFKLS

Molecular Formula

403810 (Gene_ID) O97863 (S110-S263) (Accession)

Molecular Weight

Approximately 19 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Monoclonal SUMO2 Antibody (SUMO2/1199)
NBP2-44477-0.1mg 0.1 mg

Mouse Monoclonal SUMO2 Antibody (SUMO2/1199)

Ask
View Details
ITPKC (Inositol 1,4,5-trisphosphate 3-Kinase C, IP3KC)
247769 50 µL

ITPKC (Inositol 1,4,5-trisphosphate 3-Kinase C, IP3KC)

Ask
View Details
RORC (Nuclear Receptor ROR-gamma, Nuclear Receptor RZR-gamma, Nuclear Receptor Subfamily 1 Group F Member 3, Retinoid-related Orphan Receptor-gamma, NR1F3, RORG, RZRG) (MaxLight 550)
132731-ML550 100 µL

RORC (Nuclear Receptor ROR-gamma, Nuclear Receptor RZR-gamma, Nuclear Receptor Subfamily 1 Group F Member 3, Retinoid-related Orphan Receptor-gamma, NR1F3, RORG, RZRG) (MaxLight 550)

Ask
View Details
RGS8 Rabbit pAb
E47R19864 100 µL

RGS8 Rabbit pAb

Ask
View Details
Rabbit Anti Human POFUT1 Polyclonal Antigen Affinity Purified (PBS with 0.05% sodium azide and 40% Glycerol, pH7.4)(IHC, ELISA)
MBS8424507-01 0.12 mL

Rabbit Anti Human POFUT1 Polyclonal Antigen Affinity Purified (PBS with 0.05% sodium azide and 40% Glycerol, pH7.4)(IHC, ELISA)

Ask
View Details
Rabbit Anti Human POFUT1 Polyclonal Antigen Affinity Purified (PBS with 0.05% sodium azide and 40% Glycerol, pH7.4)(IHC, ELISA)
MBS8424507-02 0.2 mL

Rabbit Anti Human POFUT1 Polyclonal Antigen Affinity Purified (PBS with 0.05% sodium azide and 40% Glycerol, pH7.4)(IHC, ELISA)

Ask
View Details