Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-33, Canine

IL-33 Protein activates NF-kappa-B and MAPK signaling, inducing Th2 cell maturation and cytokine secretion. It activates mast cells, basophils, eosinophils, and natural killer cells, acting as a chemoattractant for Th2 cells. IL-33 preserves Krebs cycle integrity, reducing reactive oxygen species production. In quiescent endothelial cells, IL-33 acts as a transcriptional repressor, but is lost upon angiogenic or pro-inflammatory activation. IL-33 Protein, Canine is the recombinant canine-derived IL-33 protein, expressed by E. coli , with N-Met labeled tag.

Product Specifications

Product Name Alternative

IL-33 Protein, Canine, Canine, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-33-protein-canine.html

Purity

95.50

Smiles

SIQEYSASLSTYNDQSITFVFEDGSYEIYVEDLRKGQEKDKVLFRYYDSQSPSHETGDDVDGQTLLVNLSPTKDKDFLLHANNEEHSVELQKCENQLPDQAFFLLHRKSSECVSFECKNNPGVFIGVKDNHLALIKVGDQTKDSYIEKTIFKLS

Molecular Formula

403810 (Gene_ID) O97863 (S110-S263) (Accession)

Molecular Weight

Approximately 19 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Monoclonal HLA DQ/DR/DP Antibody (rHLA-Pan/8847) [mFluor Violet 610 SE]
NBP3-24001MFV610 0.1 mL

Mouse Monoclonal HLA DQ/DR/DP Antibody (rHLA-Pan/8847) [mFluor Violet 610 SE]

Ask
View Details
Sub1 AAV siRNA Pooled Vector
45818164 1.0 µg

Sub1 AAV siRNA Pooled Vector

Ask
View Details
Peptidylprolyl Isomerase F / CYPF (PPIF) Antibody
abx241815-01 50 µL

Peptidylprolyl Isomerase F / CYPF (PPIF) Antibody

Ask
View Details
Peptidylprolyl Isomerase F / CYPF (PPIF) Antibody
abx241815-02 100 µL

Peptidylprolyl Isomerase F / CYPF (PPIF) Antibody

Ask
View Details
INHBC (Inhibin Beta C Chain, Activin Beta-C Chain)
406585-01 50 µL

INHBC (Inhibin Beta C Chain, Activin Beta-C Chain)

Ask
View Details
INHBC (Inhibin Beta C Chain, Activin Beta-C Chain)
406585-02 100 µL

INHBC (Inhibin Beta C Chain, Activin Beta-C Chain)

Ask
View Details