Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-33, Canine

IL-33 Protein activates NF-kappa-B and MAPK signaling, inducing Th2 cell maturation and cytokine secretion. It activates mast cells, basophils, eosinophils, and natural killer cells, acting as a chemoattractant for Th2 cells. IL-33 preserves Krebs cycle integrity, reducing reactive oxygen species production. In quiescent endothelial cells, IL-33 acts as a transcriptional repressor, but is lost upon angiogenic or pro-inflammatory activation. IL-33 Protein, Canine is the recombinant canine-derived IL-33 protein, expressed by E. coli , with N-Met labeled tag.

Product Specifications

Product Name Alternative

IL-33 Protein, Canine, Canine, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-33-protein-canine.html

Purity

95.50

Smiles

SIQEYSASLSTYNDQSITFVFEDGSYEIYVEDLRKGQEKDKVLFRYYDSQSPSHETGDDVDGQTLLVNLSPTKDKDFLLHANNEEHSVELQKCENQLPDQAFFLLHRKSSECVSFECKNNPGVFIGVKDNHLALIKVGDQTKDSYIEKTIFKLS

Molecular Formula

403810 (Gene_ID) O97863 (S110-S263) (Accession)

Molecular Weight

Approximately 19 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Homeo box C10 (HOXC10) Mouse Monoclonal Antibody [Clone ID: LBI5E6]
AMM18644VCF 100 µg

Homeo box C10 (HOXC10) Mouse Monoclonal Antibody [Clone ID: LBI5E6]

Ask
View Details
M-CSF (CSF1) (NM_172212) Human Over-expression Lysate
LY430359 100 µg

M-CSF (CSF1) (NM_172212) Human Over-expression Lysate

Ask
View Details
Lentiviral mouse Islr2 shRNA (UAS) - Lentiviral mouse Islr2 shRNA (UAS) (100)
GTR15256566 1 Vial

Lentiviral mouse Islr2 shRNA (UAS) - Lentiviral mouse Islr2 shRNA (UAS) (100)

Ask
View Details
LOXL4 Human qPCR Primer Pair (NM_032211)
HP215794 200 Reactions

LOXL4 Human qPCR Primer Pair (NM_032211)

Ask
View Details
Rabbit Polyclonal ADP-Sugar Pyrophosphatase/NUDT5 Antibody [Alexa Fluor 532]
NBP2-99496AF532 0.1 mL

Rabbit Polyclonal ADP-Sugar Pyrophosphatase/NUDT5 Antibody [Alexa Fluor 532]

Ask
View Details