Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-33, Canine

IL-33 Protein activates NF-kappa-B and MAPK signaling, inducing Th2 cell maturation and cytokine secretion. It activates mast cells, basophils, eosinophils, and natural killer cells, acting as a chemoattractant for Th2 cells. IL-33 preserves Krebs cycle integrity, reducing reactive oxygen species production. In quiescent endothelial cells, IL-33 acts as a transcriptional repressor, but is lost upon angiogenic or pro-inflammatory activation. IL-33 Protein, Canine is the recombinant canine-derived IL-33 protein, expressed by E. coli , with N-Met labeled tag.

Product Specifications

Product Name Alternative

IL-33 Protein, Canine, Canine, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-33-protein-canine.html

Purity

95.50

Smiles

SIQEYSASLSTYNDQSITFVFEDGSYEIYVEDLRKGQEKDKVLFRYYDSQSPSHETGDDVDGQTLLVNLSPTKDKDFLLHANNEEHSVELQKCENQLPDQAFFLLHRKSSECVSFECKNNPGVFIGVKDNHLALIKVGDQTKDSYIEKTIFKLS

Molecular Formula

403810 (Gene_ID) O97863 (S110-S263) (Accession)

Molecular Weight

Approximately 19 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Colloidal Gold Conjugated Sheep Purified Antibody to Mouse IgG (min. x-rxn.), 1mL 20nm
GAF-612-20 1 mL

Colloidal Gold Conjugated Sheep Purified Antibody to Mouse IgG (min. x-rxn.), 1mL 20nm

Ask
View Details
NPY (Neuropeptide Y, PYY4) (MaxLight 650)
249433-ML650 100 µL

NPY (Neuropeptide Y, PYY4) (MaxLight 650)

Ask
View Details
CBWD6, ID (CBWD6, COBW domain-containing protein 6, Cobalamin synthase W domain-containing protein 6) (MaxLight 490) discontinued
033248-ML490 100 µL

CBWD6, ID (CBWD6, COBW domain-containing protein 6, Cobalamin synthase W domain-containing protein 6) (MaxLight 490) discontinued

Ask
View Details
(+) -Arabinogalactan, from larch wood, 80%
HY-W350004-01 5 g

(+) -Arabinogalactan, from larch wood, 80%

Ask
View Details
(+) -Arabinogalactan, from larch wood, 80%
HY-W350004-02 10 g

(+) -Arabinogalactan, from larch wood, 80%

Ask
View Details
(+) -Arabinogalactan, from larch wood, 80%
HY-W350004-03 25 g

(+) -Arabinogalactan, from larch wood, 80%

Ask
View Details