Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-33, Canine

IL-33 Protein activates NF-kappa-B and MAPK signaling, inducing Th2 cell maturation and cytokine secretion. It activates mast cells, basophils, eosinophils, and natural killer cells, acting as a chemoattractant for Th2 cells. IL-33 preserves Krebs cycle integrity, reducing reactive oxygen species production. In quiescent endothelial cells, IL-33 acts as a transcriptional repressor, but is lost upon angiogenic or pro-inflammatory activation. IL-33 Protein, Canine is the recombinant canine-derived IL-33 protein, expressed by E. coli , with N-Met labeled tag.

Product Specifications

Product Name Alternative

IL-33 Protein, Canine, Canine, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-33-protein-canine.html

Purity

95.50

Smiles

SIQEYSASLSTYNDQSITFVFEDGSYEIYVEDLRKGQEKDKVLFRYYDSQSPSHETGDDVDGQTLLVNLSPTKDKDFLLHANNEEHSVELQKCENQLPDQAFFLLHRKSSECVSFECKNNPGVFIGVKDNHLALIKVGDQTKDSYIEKTIFKLS

Molecular Formula

403810 (Gene_ID) O97863 (S110-S263) (Accession)

Molecular Weight

Approximately 19 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

ZFYVE9P1 Protein Lysate (Human) with C-Ha Tag
51235031 100 µg

ZFYVE9P1 Protein Lysate (Human) with C-Ha Tag

Ask
View Details
Mouse Ferritin light chain 2, Ftl2 ELISA KIT
ELI-27552m 96 Tests

Mouse Ferritin light chain 2, Ftl2 ELISA KIT

Ask
View Details
ALK Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2H1]
TA801290AM 100 µL

ALK Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2H1]

Ask
View Details
FOXP4 (Forkhead Box Protein P4, Fork Head-related Protein-like A, FKHLA, FLJ40908, FLJ44184, hFKHLA) (PE)
MBS6157871-01 0.1 mL

FOXP4 (Forkhead Box Protein P4, Fork Head-related Protein-like A, FKHLA, FLJ40908, FLJ44184, hFKHLA) (PE)

Ask
View Details
FOXP4 (Forkhead Box Protein P4, Fork Head-related Protein-like A, FKHLA, FLJ40908, FLJ44184, hFKHLA) (PE)
MBS6157871-02 5x 0.1 mL

FOXP4 (Forkhead Box Protein P4, Fork Head-related Protein-like A, FKHLA, FLJ40908, FLJ44184, hFKHLA) (PE)

Ask
View Details
Anti-OR4X1 Antibody
CQA7615-01 30 µL

Anti-OR4X1 Antibody

Ask
View Details