Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C1QA, Mouse (His-SUMO)

The C1QA protein helps form C1, the starting component of the serum complement system. C1q binds to the zymogens C1r and C1s, resulting in C1 assembly. C1QA Protein, Mouse (His-SUMO) is the recombinant mouse-derived C1QA protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

C1QA Protein, Mouse (His-SUMO), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/c1qa-protein-mouse-his-sumo.html

Purity

95.00

Smiles

EDVCRAPNGKDGAPGNPGRPGRPGLKGERGEPGAAGIRTGIRGFKGDPGESGPPGKPGNVGLPGPSGPLGDSGPQGLKGVKGNPGNIRDQPRPAFSAIRQNPMTLGNVVIFDKVLTNQESPYQNHTGRFICAVPGFYYFNFQVISKWDLCLFIKSSSGGQPRDSLSFSNTNNKGLFQVLAGGTVLQLRRGDEVWIEKDPAKGRIYQGTEADSIFSGFLIFPSA

Molecular Formula

12259 (Gene_ID) P98086 (E23-A245) (Accession)

Molecular Weight

Approximately 42 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATG5 (Autophagy Marker) (ATG5/2553), CF488A conjugate, 0.1mg/mL
BNC882553-500 1x 500 µL

ATG5 (Autophagy Marker) (ATG5/2553), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Blocks, Kidney
CB504639 1 Block

Frozen Tissue Blocks, Kidney

Sign In for Pricing
View Details
MRPL49 Human Gene Knockout Kit (CRISPR)
KN402520 1 Kit

MRPL49 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human Kappa Light Chain (free and bound) Mouse Monoclonal Antibody [Clone ID: NaM76-5F3]
AM39033RP-N 100 Tests

Human Kappa Light Chain (free and bound) Mouse Monoclonal Antibody [Clone ID: NaM76-5F3]

Sign In for Pricing
View Details
Human Kappa Light Chain (L1C1), CF740 conjugate, 0.1mg/mL
BNC740018-500 1x 500 µL

Human Kappa Light Chain (L1C1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IKZF2 Antibody (Biotin)
KB-8003-01 50 μL

IKZF2 Antibody (Biotin)

Sign In for Pricing
View Details