Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Granulocyte-macrophage colony-stimulating factor (CSF2)

Product Specifications

Product Name Alternative

Colony-stimulating factor Short name: CSF

Abbreviation

Recombinant Bovine CSF2 protein

Gene Name

CSF2

UniProt

P11052

Expression Region

18-143aa

Organism

Bos taurus (Bovine)

Target Sequence

APTRPPNTATRPWQHVDAIKEALSLLNHSSDTDAVMNDTEVVSEKFDSQEPTCLQTRLKLYKNGLQGSLTSLMGSLTMMATHYEKHCPPTPETSCGTQFISFKNFKEDLKEFLFIIPFDCWEPAQK

Tag

C-terminal 6xHis-Myc-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Cytokine

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

18 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lymphocyte Activation Gene 3 (LAG-3) (Negative Checkpoint Regulator) (LAG3/3261), CF640R conjugate, 0.1mg/mL
BNC403261-100 1x 100 µL

Lymphocyte Activation Gene 3 (LAG-3) (Negative Checkpoint Regulator) (LAG3/3261), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Serglycin (SRGN) Human Gene Knockout Kit (CRISPR)
KN202118LP 1 Kit

Serglycin (SRGN) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Human PODXL Protein (Fc Tag)
PDMH100208-01 20 µg

Recombinant Human PODXL Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Human PODXL Protein (Fc Tag)
PDMH100208-02 100 µg

Recombinant Human PODXL Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Human PODXL Protein (Fc Tag)
PDMH100208-03 500 µg

Recombinant Human PODXL Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Human PODXL Protein (Fc Tag)
PDMH100208-04 1 mg

Recombinant Human PODXL Protein (Fc Tag)

Sign In for Pricing
View Details