Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-15 (IL15), Biotinylated

Product Specifications

Product Name Alternative

IL-15

Abbreviation

Recombinant Human IL15 protein, Biotinylated

Gene Name

IL15

UniProt

P40933

Expression Region

49-162aa

Organism

Homo sapiens (Human)

Target Sequence

NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS

Tag

C-terminal hFc1-Avi-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Metabolism

Relevance

Cytokine that plays a major role in the development of inflammatory and protective immune responses to microbial invaders and parasites by modulating immune cells of both the innate and adaptive immune systems. Stimulates the proliferation of natural killer cells, T-cells and B-cells and promotes the secretion of several cytokines. In monocytes, induces the production of IL8 and monocyte chemotactic protein 1/CCL2, two chemokines that attract neutrophils and monocytes respectively to sites of infection. Unlike most cytokines, which are secreted in soluble form, IL15 is expressed in association with its high affinity IL15RA on the surface of IL15-producing cells and delivers signals to target cells that express IL2RB and IL2RG receptor subunits. Binding to its receptor triggers the phosphorylation of JAK1 and JAK3 and the recruitment and subsequent phosphorylation of signal transducer and activator of transcription-3/STAT3 and STAT5. In mast cells, induces the rapid tyrosine phosphorylation of STAT6 and thereby controls mast cell survival and release of cytokines such as IL4.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Bioactivity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

42.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WT1 (Wilm's Tumor 1) (WT1/857 + 6F-H2), CF647 conjugate, 0.1mg/mL
BNC471138-500 1x 500 µL

WT1 (Wilm's Tumor 1) (WT1/857 + 6F-H2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD4 (T-Helper/Inducer Cell Marker) (RIV7), CF568 conjugate, 0.1mg/mL
BNC680362-100 1x 100 µL

CD4 (T-Helper/Inducer Cell Marker) (RIV7), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD30 (Ki-1/779), CF405S conjugate, 0.1mg/mL
BNC040779-100 1x 100 µL

CD30 (Ki-1/779), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD117 (C117/370), CF647 conjugate, 0.1mg/mL
BNC470370-500 1x 500 µL

CD117 (C117/370), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chromogranin A (CGA/414), CF488A conjugate, 0.1mg/mL
BNC880414-500 1x 500 µL

Chromogranin A (CGA/414), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (EGP40/826), CF568 conjugate, 0.1mg/mL
BNC680826-500 1x 500 µL

Ep-CAM / CD326 (EGP40/826), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details