Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VEGF165, Human (Biotinylated, HEK293, His-Avi)

VEGF165 Protein is a subtype of Vascular Endothelial Growth Factor A (VEGF-A) . VEGF-A is a key member of the VEGF family of cytokines that can promote neovascularization and increase vascular permeability. VEGF165 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived VEGF165 protein, expressed by HEK293 , with C-Avi, C-His labeled tag. The total length of VEGF165 Protein, Human (Biotinylated, HEK293, His-Avi) is 165 a.a., with molecular weight of 28-32 kDa.

Product Specifications

Product Name Alternative

VEGF165 Protein, Human (Biotinylated, HEK293, His-Avi), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vegf165-protein-human-biotinylated-hek293-his-avi.html

Purity

95.00

Smiles

APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVYVGARCCLMPWSLPGPHPCGPCSERR

Molecular Formula

7422 (Gene_ID) P15692-4 (A27-R191) (Accession)

Molecular Weight

Approximately 28-35 kDa under reduced (R) conditions, 45-60 kDa under non reducing (N) conditions, based on SDS-PAGE, due to the glycosylation.

References & Citations

[1]Vempati P, et al. Extracellular regulation of VEGF: isoforms, proteolysis, and vascular patterning. Cytokine Growth Factor Rev. 2014 Feb;25 (1) :1-19.|[2]Murphy JF, et al. Vascular endothelial growth factor induces cyclooxygenase-dependent proliferation of endothelial cells via the VEGF-2 receptor. FASEB J. 2001 Jul;15 (9) :1667-9.|[3]Dixelius J, et al. Minimal active domain and mechanism of action of the angiogenesis inhibitor histidine-rich glycoprotein. Cancer Res. 2006 Feb 15;66 (4) :2089-97.|[4]Glorioso N, et al. Association of ATP1A1 and dear single-nucleotide polymorphism haplotypes with essential hypertension: sex-specific and haplotype-specific effects. Circ Res. 2007 May 25;100 (10) :1522-9.|[5]Khayati F, et al. EMMPRIN/CD147 is a novel coreceptor of VEGFR-2 mediating its activation by VEGF. Oncotarget. 2015;6 (12) :9766-80.|[6]Ferrara N, et al. Molecular and biological properties of the vascular endothelial growth factor family of proteins[J]. Endocrine reviews, 1992, 13 (1) : 18-32.|[7]Ferrara N, et al. Molecular and biological properties of the vascular endothelial growth factor family of proteins. Endocr Rev. 1992 Feb;13 (1) :18-32.|[8]Terman BI, et al. Identification of the KDR tyrosine kinase as a receptor for vascular endothelial cell growth factor. Biochem Biophys Res Commun. 1992 Sep 30;187 (3) :1579-86.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUC18 / Mucin 18 / CD146 (OJ79c), CF647 conjugate, 0.1mg/mL
BNC470676-500 1x 500 µL

MUC18 / Mucin 18 / CD146 (OJ79c), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MA454), CF594 conjugate, 0.1mg/mL
BNC940008-500 1x 500 µL

MAGE A1 (MA454), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (UCHL-1), CF568 conjugate, 0.1mg/mL
BNC680003-500 1x 500 µL

CD45RO (UCHL-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Complement C4d (C4D204), CF488A conjugate, 0.1mg/mL
BNC880204-500 1x 500 µL

Complement C4d (C4D204), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/1035), CF594 conjugate, 0.1mg/mL
BNC941035-100 1x 100 µL

CD8 (C8/1035), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD59 (heavy chain of Protectin) (BRA-10G), CF640R conjugate, 0.1mg/mL
BNC400181-500 1x 500 µL

CD59 (heavy chain of Protectin) (BRA-10G), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details