Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Mucin-4 (Muc4), partial

Product Specifications

Product Name Alternative

(MUC-4) (Ascites sialoglycoprotein) (ASGP) (Pancreatic adenocarcinoma mucin) (Testis mucin) (Ascites sialoglycoprotein 1) (ASGP-1) (Ascites sialoglycoprotein 2) (ASGP-2)

Abbreviation

Recombinant Mouse Muc4 protein, partial

Gene Name

Muc4

UniProt

Q8JZM8

Expression Region

2712-2946aa

Organism

Mus musculus (Mouse)

Target Sequence

WNDKPSFCVWYQLRRPRVSCAGYRPPRPAWTFGDPHITTLDNANFTFNGLGDFLLVQAQDRNSSFLLEGRTAQTGTAKATNFIAFAAQYNTSSLKSPITVQWFLEPSDKIRVVYNNQTVAFNTRDTEVLPIFNTTGVLLTQNGSQVSANFDGTVTISVIARSNILHASSSLSEEYRNHTEGLLGVWNDNPEDDFRMPNGSTIPSNSSEETLFYYGMTWHVNGTGLLGIRADPLPT

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

A proinflammatory cytokine primarily involved in polarized T-helper 1 cell and natural killer cell immune responses. Upon binding to IL18R1 and IL18RAP, forms a signaling ternary complex which activates NF-kappa-B, triggering synthesis of inflammatory mediators. Synergizes with IL12/interleukin-12 to induce IFNG synthesis from T-helper 1 cells and natural killer cells.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

33.6 kDa

References & Citations

"Cutting edge: generation of IL-18 receptor-deficient mice: evidence for IL-1 receptor-related protein as an essential IL-18 binding receptor." Hoshino K., Tsutsui H., Kawai T., Takeda K., Nakanishi K., Takeda Y., Akira S. J. Immunol. 162:5041-5044 (1999)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR9G4 (NM_001005284) Human Over-expression Lysate
LY423843 100 µg

OR9G4 (NM_001005284) Human Over-expression Lysate

Sign In for Pricing
View Details
IFluor® 720 succinimidyl ester
1046-AAT 1 mg

IFluor® 720 succinimidyl ester

Sign In for Pricing
View Details
Bcas2 (BC013627) Mouse Tagged ORF Clone
MG200878 10 µg

Bcas2 (BC013627) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
(1R)-2,3-Dihydro-N-2-propen-1-yl-1H-inden-1-amine Ethanedioate
TRC-D450435-50MG 50 mg

(1R)-2,3-Dihydro-N-2-propen-1-yl-1H-inden-1-amine Ethanedioate

Sign In for Pricing
View Details
Dihydro Ferulic Acid 4-O-Sulfate Sodium Salt
TRC-D448915-5MG 5 mg

Dihydro Ferulic Acid 4-O-Sulfate Sodium Salt

Sign In for Pricing
View Details
MCT7 (SLC16A6) Rabbit Polyclonal Antibody
TA363746 100 µL

MCT7 (SLC16A6) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details