Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Aggregatibacter actinomycetemcomitans Beta-N-acetylhexosaminidase (dspB)

Product Specifications

Product Name Alternative

(Beta-N-acetylhexosaminidase) (Fragment)

Abbreviation

Recombinant Aggregatibacter actinomycetemcomitans dspB protein

Gene Name

DspB

UniProt

Q840G9

Expression Region

1-361aa

Organism

Aggregatibacter actinomycetemcomitans (Actinobacillus actinomycetemcomitans) (Haemophilus actinomycetemcomitans)

Target Sequence

NCCVKGNSIYPQKTSTKQTGLMLDIARHFYSPEVIKSFIDTISLSGGNFLHLHFSDHENYAIESHLLNQRAENAVQGKDGIYINPYTGKPFLSYRQLDDIKAYAKAKGIELIPELDSPNHMTAIFKLVQKDRGVKYLQGLKSRQVDDEIDITNADSITFMQSLMSEVIDIFGDTSQHFHIGGDEFGYSVESNHEFITYANKLSYFLEKKGLKTRMWNDGLIKNTFEQINPNIEITYWSYDGDTQDKNEAAERRDMRVSLPELLAKGFTVLNYNSYYLYIVPKASPTFSQDAAFAAKDVIKNWDLGVWDGRNTKNRVQNTHEIAGAALSIWGEDAKALKDETIQKNTKSLLEAVIHKTNGDE

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

48.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNF alpha (J2D10), CF640R conjugate, 0.1mg/mL
BNC400994-100 1x 100 µL

TNF alpha (J2D10), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (101-1D2), CF594 conjugate, 0.1mg/mL
BNC940177-100 1x 100 µL

CD50 (ICAM-3) (101-1D2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chromogranin A / CHGA (Neuroendocrine Marker) (CHGA/1731R), CF488A conjugate, 0.1mg/mL
BNC881731-100 1x 100 µL

Chromogranin A / CHGA (Neuroendocrine Marker) (CHGA/1731R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), 0.2mg/mL
BNUB0017-100 1x 100 µL

Ep-CAM / CD326 (VU-1D9), 0.2mg/mL

Sign In for Pricing
View Details
VEGF-A (VEGF/1063), CF568 conjugate, 0.1mg/mL
BNC681063-500 1x 500 µL

VEGF-A (VEGF/1063), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ksp-Cadherin (Kidney-Specific Cadherin) / CDH16 (CDH16/1532R), CF594 conjugate, 0.1mg/mL
BNC941532-100 1x 100 µL

Ksp-Cadherin (Kidney-Specific Cadherin) / CDH16 (CDH16/1532R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details