Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RNF5, Human (Cell-Free, His)

The RNF5 protein is a membrane-bound E3 ubiquitin protein ligase that is critical for ubiquitination of target proteins and can cooperate with UBE2D1/UBCH5A and UBE2D2/UBC4 to achieve ubiquitination over a broad substrate range. Notably, it mediates PXN/paxillin ubiquitination, affecting cell motility and cell positioning. RNF5 Protein, Human (Cell-Free, His) is the recombinant human-derived RNF5 protein, expressed by E. coli Cell-free , with N-10*His labeled tag.

Product Specifications

Product Name Alternative

RNF5 Protein, Human (Cell-Free, His), Human, E. coli Cell-free

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rnf5-protein-human-cf-his.html

Purity

90.00

Smiles

AAAEEEDGGPEGPNRERGGAGATFECNICLETAREAVVSVCGHLYCWPCLHQWLETRPERQECPVCKAGISREKVVPLYGRGSQKPQDPRLKTPPRPQGQRPAPESRGGFQPFGDTGGFHFSFGVGAFPFGFFTTVFNAHEPFRRGTGVDLGQGHPASSWQDSLFLFLAIFFFFWLLSI

Molecular Formula

6048 (Gene_ID) Q99942 (A2-I180) (Accession)

Molecular Weight

27 kDa&54 kDa&108 kDa. It is speculated that the protein forms a multimer structure.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Lentiviral human ATP8A2 shRNA (UAS) - Lentiviral human ATP8A2 shRNA (UAS, RFP) (100)
GTR15104760 1 Vial

Lentiviral human ATP8A2 shRNA (UAS) - Lentiviral human ATP8A2 shRNA (UAS, RFP) (100)

Ask
View Details
Ghrh Rat Pre-designed siRNA Set A
HY-RS23191 1 Set

Ghrh Rat Pre-designed siRNA Set A

Ask
View Details
Thtpa siRNA Oligos set (Mouse)
46678174 3x 5 nmol

Thtpa siRNA Oligos set (Mouse)

Ask
View Details
Lentiviral human OTOP2 shRNA (UAS) - Lentiviral human OTOP2 shRNA (UAS, GFP) plasmid
GTR15098638 1 Vial

Lentiviral human OTOP2 shRNA (UAS) - Lentiviral human OTOP2 shRNA (UAS, GFP) plasmid

Ask
View Details
ZRANB2 siRNA (h)
sc-78863 10 µM

ZRANB2 siRNA (h)

Ask
View Details