Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RNF5, Human (Cell-Free, His)

The RNF5 protein is a membrane-bound E3 ubiquitin protein ligase that is critical for ubiquitination of target proteins and can cooperate with UBE2D1/UBCH5A and UBE2D2/UBC4 to achieve ubiquitination over a broad substrate range. Notably, it mediates PXN/paxillin ubiquitination, affecting cell motility and cell positioning. RNF5 Protein, Human (Cell-Free, His) is the recombinant human-derived RNF5 protein, expressed by E. coli Cell-free , with N-10*His labeled tag.

Product Specifications

Product Name Alternative

RNF5 Protein, Human (Cell-Free, His), Human, E. coli Cell-free

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rnf5-protein-human-cf-his.html

Purity

90.00

Smiles

AAAEEEDGGPEGPNRERGGAGATFECNICLETAREAVVSVCGHLYCWPCLHQWLETRPERQECPVCKAGISREKVVPLYGRGSQKPQDPRLKTPPRPQGQRPAPESRGGFQPFGDTGGFHFSFGVGAFPFGFFTTVFNAHEPFRRGTGVDLGQGHPASSWQDSLFLFLAIFFFFWLLSI

Molecular Formula

6048 (Gene_ID) Q99942 (A2-I180) (Accession)

Molecular Weight

27 kDa&54 kDa&108 kDa. It is speculated that the protein forms a multimer structure.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

GTF2IRD2B, CT (GTF2IRD2B, General transcription factor II-I repeat domain-containing protein 2B, Transcription factor GTF2IRD2-beta) (Biotin) discontinued
036363-Biotin 200 µL

GTF2IRD2B, CT (GTF2IRD2B, General transcription factor II-I repeat domain-containing protein 2B, Transcription factor GTF2IRD2-beta) (Biotin) discontinued

Ask
View Details
Mouse Laminin subunit alpha-1 ELISA Kit
MBS2886156-01 48 Well

Mouse Laminin subunit alpha-1 ELISA Kit

Ask
View Details
Mouse Laminin subunit alpha-1 ELISA Kit
MBS2886156-02 96 Well

Mouse Laminin subunit alpha-1 ELISA Kit

Ask
View Details
Mouse Laminin subunit alpha-1 ELISA Kit
MBS2886156-03 5x 96 Well

Mouse Laminin subunit alpha-1 ELISA Kit

Ask
View Details
Mouse Laminin subunit alpha-1 ELISA Kit
MBS2886156-04 10x 96 Well

Mouse Laminin subunit alpha-1 ELISA Kit

Ask
View Details
Human Olfactory receptor 5H1, OR5H1 ELISA KIT
ELI-44370h 96 Tests

Human Olfactory receptor 5H1, OR5H1 ELISA KIT

Ask
View Details