Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EIF5A, Human (His)

The GSK-3 beta protein is an enzyme that plays a crucial role in multiple cellular processes, including cell proliferation, differentiation, and apoptosis. It regulates various signaling pathways and is involved in the development of several diseases, such as cancer and neurodegenerative disorders. GSK-3 beta is active in its unphosphorylated form and can phosphorylate a wide range of substrates to modulate cellular functions. EIF5A Protein, Human (His) is the recombinant human-derived EIF5A protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

EIF5A Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/eif5a-protein-human-his.html

Purity

95.0

Smiles

MADDLDFETGDAGASATFPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDFQLIGIQDGYLSLLQDSGEVREDLRLPEGDLGKEIEQKYDCGEEILITVLSAMTEEAAVAIKAMAK

Molecular Formula

1984 (Gene_ID) NP_001961 (M1-K154) (Accession)

Molecular Weight

Approximately 19 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse 9930021J03Rik shRNA (UAS) - Lentiviral mouse 9930021J03Rik shRNA (UAS, iRFP) plasmid
GTR15192256 1 Vial

Lentiviral mouse 9930021J03Rik shRNA (UAS) - Lentiviral mouse 9930021J03Rik shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
PRDX3 Conjugated Antibody
C35890 100 µL

PRDX3 Conjugated Antibody

Sign In for Pricing
View Details
Lentiviral human SH2B1 sgRNA gene knockout kit - Lentiviral human SH2B1 sgRNA gene knockout kit (plasmid)
GTR15389090 1 Vial

Lentiviral human SH2B1 sgRNA gene knockout kit - Lentiviral human SH2B1 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
Recombinant Mycobacterium Leprae ctpA Protein (aa 1-780)
VAng-Yyj1891-1mgEcoli 1 mg (E. coli)

Recombinant Mycobacterium Leprae ctpA Protein (aa 1-780)

Sign In for Pricing
View Details
EGFR Antibody [Cocktail R19/48 (111.6 + 199.12 + F4 + 11E8)]
GWB-B90B6D 0.05 mg

EGFR Antibody [Cocktail R19/48 (111.6 + 199.12 + F4 + 11E8)]

Sign In for Pricing
View Details
SIRT2 antibody - C-terminal region (ARP32385_P050)
ARP32385_P050 100 µL

SIRT2 antibody - C-terminal region (ARP32385_P050)

Sign In for Pricing
View Details