Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EIF5A, Human (His)

The GSK-3 beta protein is an enzyme that plays a crucial role in multiple cellular processes, including cell proliferation, differentiation, and apoptosis. It regulates various signaling pathways and is involved in the development of several diseases, such as cancer and neurodegenerative disorders. GSK-3 beta is active in its unphosphorylated form and can phosphorylate a wide range of substrates to modulate cellular functions. EIF5A Protein, Human (His) is the recombinant human-derived EIF5A protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

EIF5A Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/eif5a-protein-human-his.html

Purity

95.0

Smiles

MADDLDFETGDAGASATFPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDFQLIGIQDGYLSLLQDSGEVREDLRLPEGDLGKEIEQKYDCGEEILITVLSAMTEEAAVAIKAMAK

Molecular Formula

1984 (Gene_ID) NP_001961 (M1-K154) (Accession)

Molecular Weight

Approximately 19 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human Putative RNA-binding protein 3, RBM3 ELISA KIT
ELI-04226h 96 Tests

Human Putative RNA-binding protein 3, RBM3 ELISA KIT

Ask
View Details
IKZF3 Mouse Monoclonal Antibody [Clone ID: LBI7E11]
AMM16463V 100 µL

IKZF3 Mouse Monoclonal Antibody [Clone ID: LBI7E11]

Ask
View Details
Rabbit Monoclonal Histone H2A.Z [ac Lys7] Antibody (RM222) [Janelia Fluor 549]
NBP3-26026JF549 0.1 mL

Rabbit Monoclonal Histone H2A.Z [ac Lys7] Antibody (RM222) [Janelia Fluor 549]

Ask
View Details
Ctsl1 AAV siRNA Pooled Vector
17104166 1.0 μg

Ctsl1 AAV siRNA Pooled Vector

Ask
View Details
FBXO28 (NM_001136115) Human Tagged Lenti ORF Clone
RC226865L3 10 µg

FBXO28 (NM_001136115) Human Tagged Lenti ORF Clone

Ask
View Details