Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EIF5A, Human (His)

The GSK-3 beta protein is an enzyme that plays a crucial role in multiple cellular processes, including cell proliferation, differentiation, and apoptosis. It regulates various signaling pathways and is involved in the development of several diseases, such as cancer and neurodegenerative disorders. GSK-3 beta is active in its unphosphorylated form and can phosphorylate a wide range of substrates to modulate cellular functions. EIF5A Protein, Human (His) is the recombinant human-derived EIF5A protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

EIF5A Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/eif5a-protein-human-his.html

Purity

95.0

Smiles

MADDLDFETGDAGASATFPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDFQLIGIQDGYLSLLQDSGEVREDLRLPEGDLGKEIEQKYDCGEEILITVLSAMTEEAAVAIKAMAK

Molecular Formula

1984 (Gene_ID) NP_001961 (M1-K154) (Accession)

Molecular Weight

Approximately 19 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPP2R4 Protein Lysate (Rat) with C-HA Tag
37481036 100 µg

PPP2R4 Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
pUNO1-hTRAF6-DN
puno1-htraf6-dn 20 µg

pUNO1-hTRAF6-DN

Sign In for Pricing
View Details
TLL2 Protein Vector (Human) (pPM-C-HA)
46767021 500 ng

TLL2 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Recombinant Rat Cd52 Protein, Fc-tagged, Alexa Fluor 647 conjugated
Cd52-7479RAF647 20 μg- 50 μg- 100 μg

Recombinant Rat Cd52 Protein, Fc-tagged, Alexa Fluor 647 conjugated

Sign In for Pricing
View Details
Tsx Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV625087 1.0 µg DNA

Tsx Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
ZNF767 shRNA (h) Lentiviral Particles
sc-89485-V 200 µL

ZNF767 shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details