Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Synaptophysin (SYP)

Product Specifications

Product Name Alternative

Major synaptic vesicle protein p38

Abbreviation

Recombinant Human SYP protein

Gene Name

SYP

UniProt

P08247

Expression Region

1-313aa

Organism

Homo sapiens (Human)

Target Sequence

MLLLADMDVVNQLVAGGQFRVVKEPLGFVKVLQWVFAIFAFATCGSYSGELQLSVDCANKTESDLSIEVEFEYPFRLHQVYFDAPTCRGGTTKVFLVGDYSSSAEFFVTVAVFAFLYSMGALATYIFLQNKYRENNKGPMLDFLATAVFAFMWLVSSSAWAKGLSDVKMATDPENIIKEMPVCRQTGNTCKELRDPVTSGLNTSVVFGFLNLVLWVGNLWFVFKETGWAAPFLRAPPGAPEKQPAPGDAYGDAGYGQGPGGYGPQDSYGPQGGYQPDYGQPAGSGGSGYGPQGDYGQQGYGPQGAPTSFSNQM

Tag

N-terminal 10xHis-tagged

Type

CF Transmembrane Protein & In Stock Protein

Source

In vitro E.coli expression system

Field of Research

Neuroscience

Relevance

Possibly involved in structural functions as organizing other membrane components or in targeting the vesicles to the plasma membrane. Involved in the regulation of short-term and long-term synaptic plasticity.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Bioactivity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

39.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RBM4 Blocking Peptide
33R-8981 100 ug

RBM4 Blocking Peptide

Sign In for Pricing
View Details
FAM185BP Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV761249 1.0 µg DNA

FAM185BP Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
MUC2 Rabbit monoclonal antibody
E43S40473 100 µL

MUC2 Rabbit monoclonal antibody

Sign In for Pricing
View Details
HDGFL1 Rabbit Polyclonal Antibody (PE-Cy5.5)
orb930061 100 µL

HDGFL1 Rabbit Polyclonal Antibody (PE-Cy5.5)

Sign In for Pricing
View Details
RPL36AP47 CRISPRa sgRNA lentivector (set of three targets)(Human)
41575121 3x 1.0µg DNA

RPL36AP47 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
Naphthalene-2,6-dicarboxylic acid
OR7563-01 5 g

Naphthalene-2,6-dicarboxylic acid

Sign In for Pricing
View Details