Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Synaptophysin (SYP)

Product Specifications

Product Name Alternative

Major synaptic vesicle protein p38

Abbreviation

Recombinant Human SYP protein

Gene Name

SYP

UniProt

P08247

Expression Region

1-313aa

Organism

Homo sapiens (Human)

Target Sequence

MLLLADMDVVNQLVAGGQFRVVKEPLGFVKVLQWVFAIFAFATCGSYSGELQLSVDCANKTESDLSIEVEFEYPFRLHQVYFDAPTCRGGTTKVFLVGDYSSSAEFFVTVAVFAFLYSMGALATYIFLQNKYRENNKGPMLDFLATAVFAFMWLVSSSAWAKGLSDVKMATDPENIIKEMPVCRQTGNTCKELRDPVTSGLNTSVVFGFLNLVLWVGNLWFVFKETGWAAPFLRAPPGAPEKQPAPGDAYGDAGYGQGPGGYGPQDSYGPQGGYQPDYGQPAGSGGSGYGPQGDYGQQGYGPQGAPTSFSNQM

Tag

N-terminal 10xHis-tagged

Type

CF Transmembrane Protein & In Stock Protein

Source

In vitro E.coli expression system

Field of Research

Neuroscience

Relevance

Possibly involved in structural functions as organizing other membrane components or in targeting the vesicles to the plasma membrane. Involved in the regulation of short-term and long-term synaptic plasticity.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Bioactivity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

39.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat IDO (Indoleamine-2,3-Dioxygenase) ELISA Kit
EK245209 96 Well

Rat IDO (Indoleamine-2,3-Dioxygenase) ELISA Kit

Sign In for Pricing
View Details
pOTB7-ZNF576 Plasmid
PVT24062 2 µg

pOTB7-ZNF576 Plasmid

Sign In for Pricing
View Details
Mouse Anti-Human CD19-PE/TXRD
9340-10 100 Tests

Mouse Anti-Human CD19-PE/TXRD

Sign In for Pricing
View Details
Recombinant Transforming Growth Factor Beta 1 (TGFb1)
SIPA079Mu01-01 10 µg

Recombinant Transforming Growth Factor Beta 1 (TGFb1)

Sign In for Pricing
View Details
Recombinant Transforming Growth Factor Beta 1 (TGFb1)
SIPA079Mu01-02 50 µg

Recombinant Transforming Growth Factor Beta 1 (TGFb1)

Sign In for Pricing
View Details
Recombinant Transforming Growth Factor Beta 1 (TGFb1)
SIPA079Mu01-03 200 µg

Recombinant Transforming Growth Factor Beta 1 (TGFb1)

Sign In for Pricing
View Details