Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-13, Mouse (HEK293, His)

IL-13 protein is a cytokine involved in allergic inflammation, immune response to parasites, and B cell proliferation. IL-13 Protein, Mouse (HEK293, His) is the recombinant mouse-derived IL-13 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

IL-13 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-13-protein-mouse-hek293-his.html

Purity

98.0

Smiles

PVPRSVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPF

Molecular Formula

16163 (Gene_ID) P20109 (P22-F131) (Accession)

Molecular Weight

Approximately 14-30 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CTPA2 Antibody
orb786958 2 mg

CTPA2 Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal Histone H4 [ac Lys8] Antibody
NB21-2044 0.05 mg

Rabbit Polyclonal Histone H4 [ac Lys8] Antibody

Sign In for Pricing
View Details
OSR2 Rabbit pAb
E45R24275N 50 ul

OSR2 Rabbit pAb

Sign In for Pricing
View Details
Recombinant Human NEDD8 Protein
E30P11765 20 µg

Recombinant Human NEDD8 Protein

Sign In for Pricing
View Details
Moesin Rabbit Polyclonal Antibody (HRP)
orb479756 100 µL

Moesin Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
ARK-1 (phospho Thr288) Polyclonal Antibody
orb1415072 100 µL

ARK-1 (phospho Thr288) Polyclonal Antibody

Sign In for Pricing
View Details