Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNFRSF13B, Mouse (HEK293, Fc)

The TNFRSF13B protein is a receptor for TNFSF13/APRIL and TNFSF13B/TALL1/BAFF/BLYS and binds these two ligands with high affinity. It mediates calcineurin-dependent activation of NF-AT as well as NF-kappa-B and AP-1, contributing to B- and T-cell function and humoral immune regulation. TNFRSF13B Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived TNFRSF13B protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

TNFRSF13B Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tnfrsf13b-protein-mouse-hek-293-fc.html

Purity

95.10

Smiles

FCPKDQYWDSSRKSCVSCALTCSQRSQRTCTDFCKFINCRKEQGRYYDHLLGACVSCDSTCTQHPQQCAHFCEKRPRSQANLQPELGRPQAGEVEVRSDNSGRHQGSEHGPGLRLSSDQLTLYCT

Molecular Formula

57916 (Gene_ID) Q9ET35 (F5-T129) (Accession)

Molecular Weight

40-45 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Neuroglobin, NGB ELISA Kit
MBS163259-01 48 Well

Human Neuroglobin, NGB ELISA Kit

Sign In for Pricing
View Details
Human Neuroglobin, NGB ELISA Kit
MBS163259-02 96 Well

Human Neuroglobin, NGB ELISA Kit

Sign In for Pricing
View Details
Human Neuroglobin, NGB ELISA Kit
MBS163259-03 5x 96 Well

Human Neuroglobin, NGB ELISA Kit

Sign In for Pricing
View Details
Human Neuroglobin, NGB ELISA Kit
MBS163259-04 10x 96 Well

Human Neuroglobin, NGB ELISA Kit

Sign In for Pricing
View Details
CBX5 Antibody, Biotin conjugated
A16117-50UG 50 µg

CBX5 Antibody, Biotin conjugated

Sign In for Pricing
View Details
CALmL5 CytoSection
TS404372P5 25 Slides

CALmL5 CytoSection

Sign In for Pricing
View Details