Klrb1a, Mouse (HEK293, His)
The Klrb1a protein is critical for stimulating NK cell cytotoxicity and contributes to immune defense mechanisms.Klrb1a exists as a homodimer with disulfide bonds and complexly regulates NK cell activity.Klrb1a Protein, Mouse (HEK293, His) is the recombinant mouse-derived Klrb1a protein, expressed by HEK293 , with N-His labeled tag.
Product Specifications
Product Name Alternative
Klrb1a Protein, Mouse (HEK293, His), Mouse, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/klrb1a-protein-mouse-hek293-his.html
Purity
95.00
Smiles
QKPSIEKCYVLIQENLNKTTDCSAKLECPQDWLSHRDKCFHVSHVSNTWEEGLVDCDGKGATLMLIQDQEELRFLLDSIKEKYNSFWIGLRYTLPDMNWKWINGSTLNSDVLKITDDTENDSCAAISGDKVTFESCNSDNRWICQKELYHETLSNYVGYGH
Molecular Formula
17057 (Gene_ID) P27811 (Q67-H227) (Accession)
Molecular Weight
Approximately 24-33 kDa due to the glycosylation
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
K4210604 1.0 µg DNA
Olfr791 sgRNA CRISPR Lentivector (Mouse) (Target 3)
Sign In for Pricing
View Details MBS713915-01 0.1 mL
Rabbit anti-human neurofilament, light polypeptide polyclonal Antibody
Sign In for Pricing
View Details 
MBS713915-02 5x 0.1 mL
Rabbit anti-human neurofilament, light polypeptide polyclonal Antibody
Sign In for Pricing
View Details 
K6530208 1.0 µg DNA
Rin3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
Sign In for Pricing
View Details