Klrb1a, Mouse (HEK293, His)
The Klrb1a protein is critical for stimulating NK cell cytotoxicity and contributes to immune defense mechanisms.Klrb1a exists as a homodimer with disulfide bonds and complexly regulates NK cell activity.Klrb1a Protein, Mouse (HEK293, His) is the recombinant mouse-derived Klrb1a protein, expressed by HEK293 , with N-His labeled tag.
Product Specifications
Product Name Alternative
Klrb1a Protein, Mouse (HEK293, His), Mouse, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/klrb1a-protein-mouse-hek293-his.html
Purity
95.00
Smiles
QKPSIEKCYVLIQENLNKTTDCSAKLECPQDWLSHRDKCFHVSHVSNTWEEGLVDCDGKGATLMLIQDQEELRFLLDSIKEKYNSFWIGLRYTLPDMNWKWINGSTLNSDVLKITDDTENDSCAAISGDKVTFESCNSDNRWICQKELYHETLSNYVGYGH
Molecular Formula
17057 (Gene_ID) P27811 (Q67-H227) (Accession)
Molecular Weight
Approximately 24-33 kDa due to the glycosylation
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Mouse Monoclonal ROR1 Antibody (02) [Janelia Fluor 585]](https://cdn.genprice.uk/genprice/uk/genprice4.webp)
NBP3-30735JF585 0.1 mL
Mouse Monoclonal ROR1 Antibody (02) [Janelia Fluor 585]
Sign In for Pricing
View Details 
MBS077424-01 48 Well
Hamster Gamma-Secretase Activating Protein ELISA Kit
Sign In for Pricing
View Details MBS077424-02 96 Well
Hamster Gamma-Secretase Activating Protein ELISA Kit
Sign In for Pricing
View Details MBS077424-03 5x 96 Well
Hamster Gamma-Secretase Activating Protein ELISA Kit
Sign In for Pricing
View Details 
MBS077424-04 10x 96 Well
Hamster Gamma-Secretase Activating Protein ELISA Kit
Sign In for Pricing
View Details