Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Klrb1a, Mouse (HEK293, His)

The Klrb1a protein is critical for stimulating NK cell cytotoxicity and contributes to immune defense mechanisms.Klrb1a exists as a homodimer with disulfide bonds and complexly regulates NK cell activity.Klrb1a Protein, Mouse (HEK293, His) is the recombinant mouse-derived Klrb1a protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

Klrb1a Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/klrb1a-protein-mouse-hek293-his.html

Purity

95.00

Smiles

QKPSIEKCYVLIQENLNKTTDCSAKLECPQDWLSHRDKCFHVSHVSNTWEEGLVDCDGKGATLMLIQDQEELRFLLDSIKEKYNSFWIGLRYTLPDMNWKWINGSTLNSDVLKITDDTENDSCAAISGDKVTFESCNSDNRWICQKELYHETLSNYVGYGH

Molecular Formula

17057 (Gene_ID) P27811 (Q67-H227) (Accession)

Molecular Weight

Approximately 24-33 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

gamma Tubulin (TUBG1) (434-449) Mouse Monoclonal Antibody [Clone ID: TU-32]
AM03180PU-N 100 µg

gamma Tubulin (TUBG1) (434-449) Mouse Monoclonal Antibody [Clone ID: TU-32]

Sign In for Pricing
View Details
CTAGE1 Lentiviral Activation Particles (h)
sc-406178-LAC 200 µL

CTAGE1 Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
Human INTS8 shRNA Plasmid
abx960807-01 150 µg

Human INTS8 shRNA Plasmid

Sign In for Pricing
View Details
Human INTS8 shRNA Plasmid
abx960807-02 300 µg

Human INTS8 shRNA Plasmid

Sign In for Pricing
View Details
Chicken ADP-ribosylation factor-binding protein GGA1 (GGA1) ELISA Kit
MBS7239073-01 48 Well

Chicken ADP-ribosylation factor-binding protein GGA1 (GGA1) ELISA Kit

Sign In for Pricing
View Details
Chicken ADP-ribosylation factor-binding protein GGA1 (GGA1) ELISA Kit
MBS7239073-02 96 Well

Chicken ADP-ribosylation factor-binding protein GGA1 (GGA1) ELISA Kit

Sign In for Pricing
View Details