Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Klrb1a, Mouse (HEK293, His)

The Klrb1a protein is critical for stimulating NK cell cytotoxicity and contributes to immune defense mechanisms.Klrb1a exists as a homodimer with disulfide bonds and complexly regulates NK cell activity.Klrb1a Protein, Mouse (HEK293, His) is the recombinant mouse-derived Klrb1a protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

Klrb1a Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/klrb1a-protein-mouse-hek293-his.html

Purity

95.00

Smiles

QKPSIEKCYVLIQENLNKTTDCSAKLECPQDWLSHRDKCFHVSHVSNTWEEGLVDCDGKGATLMLIQDQEELRFLLDSIKEKYNSFWIGLRYTLPDMNWKWINGSTLNSDVLKITDDTENDSCAAISGDKVTFESCNSDNRWICQKELYHETLSNYVGYGH

Molecular Formula

17057 (Gene_ID) P27811 (Q67-H227) (Accession)

Molecular Weight

Approximately 24-33 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nicorandil Impurity 8
RM-N031834-01 10 mg

Nicorandil Impurity 8

Sign In for Pricing
View Details
Nicorandil Impurity 8
RM-N031834-02 25 mg

Nicorandil Impurity 8

Sign In for Pricing
View Details
Nicorandil Impurity 8
RM-N031834-03 50 mg

Nicorandil Impurity 8

Sign In for Pricing
View Details
Nicorandil Impurity 8
RM-N031834-04 100 mg

Nicorandil Impurity 8

Sign In for Pricing
View Details
Human SLC13A5 Knockout HEK293T cell line
GTR15411156 1 Vial

Human SLC13A5 Knockout HEK293T cell line

Sign In for Pricing
View Details
Rat Endothelial cell-specific molecule 1, ESM-1 ELISA KIT
E0961Ra-01 48 Well

Rat Endothelial cell-specific molecule 1, ESM-1 ELISA KIT

Sign In for Pricing
View Details