Klrb1a, Mouse (HEK293, His)
The Klrb1a protein is critical for stimulating NK cell cytotoxicity and contributes to immune defense mechanisms.Klrb1a exists as a homodimer with disulfide bonds and complexly regulates NK cell activity.Klrb1a Protein, Mouse (HEK293, His) is the recombinant mouse-derived Klrb1a protein, expressed by HEK293 , with N-His labeled tag.
Product Specifications
Product Name Alternative
Klrb1a Protein, Mouse (HEK293, His), Mouse, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/klrb1a-protein-mouse-hek293-his.html
Purity
95.00
Smiles
QKPSIEKCYVLIQENLNKTTDCSAKLECPQDWLSHRDKCFHVSHVSNTWEEGLVDCDGKGATLMLIQDQEELRFLLDSIKEKYNSFWIGLRYTLPDMNWKWINGSTLNSDVLKITDDTENDSCAAISGDKVTFESCNSDNRWICQKELYHETLSNYVGYGH
Molecular Formula
17057 (Gene_ID) P27811 (Q67-H227) (Accession)
Molecular Weight
Approximately 24-33 kDa due to the glycosylation
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
RC208004L2V 200 µL
AMIGO2 (NM_181847) Human Tagged ORF Clone Lentiviral Particle
Sign In for Pricing
View Details ![Mouse Monoclonal pan Actin Antibody (MSA/953) [DyLight 405]](https://cdn.genprice.uk/genprice/uk/genprice4.webp)
NBP2-47662V 0.1 mL
Mouse Monoclonal pan Actin Antibody (MSA/953) [DyLight 405]
Sign In for Pricing
View Details RC208525L3V 200 µL
Dynamin 2 (DNM2) (NM_004945) Human Tagged ORF Clone Lentiviral Particle
Sign In for Pricing
View Details MBS1273778-01 0.01 mg Plasmid + 0.2 mL Glycerol-Stock
NPY cDNA Clone
Sign In for Pricing
View Details