Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Klrb1a, Mouse (HEK293, His)

The Klrb1a protein is critical for stimulating NK cell cytotoxicity and contributes to immune defense mechanisms.Klrb1a exists as a homodimer with disulfide bonds and complexly regulates NK cell activity.Klrb1a Protein, Mouse (HEK293, His) is the recombinant mouse-derived Klrb1a protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

Klrb1a Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/klrb1a-protein-mouse-hek293-his.html

Purity

95.00

Smiles

QKPSIEKCYVLIQENLNKTTDCSAKLECPQDWLSHRDKCFHVSHVSNTWEEGLVDCDGKGATLMLIQDQEELRFLLDSIKEKYNSFWIGLRYTLPDMNWKWINGSTLNSDVLKITDDTENDSCAAISGDKVTFESCNSDNRWICQKELYHETLSNYVGYGH

Molecular Formula

17057 (Gene_ID) P27811 (Q67-H227) (Accession)

Molecular Weight

Approximately 24-33 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sodium Hydroxide 6M (6N) Solution
2424I 01000 1 L

Sodium Hydroxide 6M (6N) Solution

Sign In for Pricing
View Details
RASAL2 Recombinant Protein Antigen
NBP1-82578PEP 0.1 mL

RASAL2 Recombinant Protein Antigen

Sign In for Pricing
View Details
Pebp1 3'UTR Luciferase Stable Cell Line
TU216065 1.0 mL

Pebp1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Occludin (FITC) (AP) discontinued
O5203-AP 100 µL

Occludin (FITC) (AP) discontinued

Sign In for Pricing
View Details
FAT2 siRNA (Rat)
CRR2032-01 15 nmol

FAT2 siRNA (Rat)

Sign In for Pricing
View Details
FAT2 siRNA (Rat)
CRR2032-02 30 nmol

FAT2 siRNA (Rat)

Sign In for Pricing
View Details