Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Klrb1a, Mouse (HEK293, His)

The Klrb1a protein is critical for stimulating NK cell cytotoxicity and contributes to immune defense mechanisms.Klrb1a exists as a homodimer with disulfide bonds and complexly regulates NK cell activity.Klrb1a Protein, Mouse (HEK293, His) is the recombinant mouse-derived Klrb1a protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

Klrb1a Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/klrb1a-protein-mouse-hek293-his.html

Purity

95.00

Smiles

QKPSIEKCYVLIQENLNKTTDCSAKLECPQDWLSHRDKCFHVSHVSNTWEEGLVDCDGKGATLMLIQDQEELRFLLDSIKEKYNSFWIGLRYTLPDMNWKWINGSTLNSDVLKITDDTENDSCAAISGDKVTFESCNSDNRWICQKELYHETLSNYVGYGH

Molecular Formula

17057 (Gene_ID) P27811 (Q67-H227) (Accession)

Molecular Weight

Approximately 24-33 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

AKT2 Antibody
R35817-100UG 100 µg

AKT2 Antibody

Sign In for Pricing
View Details
Potassium sorbate, granular
GRM1311-1KG 1 unit

Potassium sorbate, granular

Sign In for Pricing
View Details
Rabbit Polyclonal SMAD6 Antibody [DyLight 680]
NB100-56440FR 0.1 mL

Rabbit Polyclonal SMAD6 Antibody [DyLight 680]

Sign In for Pricing
View Details
Mouse CC16 (Clara Cell Protein 16) ELISA Kit
EK241156 96 Well

Mouse CC16 (Clara Cell Protein 16) ELISA Kit

Sign In for Pricing
View Details
GDEP Protein Vector (Human) (pPB-C-His)
PV052581 500 ng

GDEP Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
SRrp130 HDR Plasmid (m)
sc-426116-HDR 20 µg

SRrp130 HDR Plasmid (m)

Sign In for Pricing
View Details