Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Klrb1a, Mouse (HEK293, His)

The Klrb1a protein is critical for stimulating NK cell cytotoxicity and contributes to immune defense mechanisms.Klrb1a exists as a homodimer with disulfide bonds and complexly regulates NK cell activity.Klrb1a Protein, Mouse (HEK293, His) is the recombinant mouse-derived Klrb1a protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

Klrb1a Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/klrb1a-protein-mouse-hek293-his.html

Purity

95.00

Smiles

QKPSIEKCYVLIQENLNKTTDCSAKLECPQDWLSHRDKCFHVSHVSNTWEEGLVDCDGKGATLMLIQDQEELRFLLDSIKEKYNSFWIGLRYTLPDMNWKWINGSTLNSDVLKITDDTENDSCAAISGDKVTFESCNSDNRWICQKELYHETLSNYVGYGH

Molecular Formula

17057 (Gene_ID) P27811 (Q67-H227) (Accession)

Molecular Weight

Approximately 24-33 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOSL1 degrader 1 5mg
A23949-5 5 mg

FOSL1 degrader 1 5mg

Sign In for Pricing
View Details
P21 Protein Activated Kinase 2 (PAK2) Antibody
abx214206-01 50 µL

P21 Protein Activated Kinase 2 (PAK2) Antibody

Sign In for Pricing
View Details
P21 Protein Activated Kinase 2 (PAK2) Antibody
abx214206-02 100 µL

P21 Protein Activated Kinase 2 (PAK2) Antibody

Sign In for Pricing
View Details
Cat Kelch-Like Protein 24 (KLHL24) ELISA Kit
MBS9357036 Inquire

Cat Kelch-Like Protein 24 (KLHL24) ELISA Kit

Sign In for Pricing
View Details
Tubulin delta Chain (Delta-tubulin, TUBD, TUBD1) (FITC)
MBS6397548-01 0.1 mL

Tubulin delta Chain (Delta-tubulin, TUBD, TUBD1) (FITC)

Sign In for Pricing
View Details
Tubulin delta Chain (Delta-tubulin, TUBD, TUBD1) (FITC)
MBS6397548-02 5x 0.1 mL

Tubulin delta Chain (Delta-tubulin, TUBD, TUBD1) (FITC)

Sign In for Pricing
View Details