Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Klrb1a, Mouse (HEK293, His)

The Klrb1a protein is critical for stimulating NK cell cytotoxicity and contributes to immune defense mechanisms.Klrb1a exists as a homodimer with disulfide bonds and complexly regulates NK cell activity.Klrb1a Protein, Mouse (HEK293, His) is the recombinant mouse-derived Klrb1a protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

Klrb1a Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/klrb1a-protein-mouse-hek293-his.html

Purity

95.00

Smiles

QKPSIEKCYVLIQENLNKTTDCSAKLECPQDWLSHRDKCFHVSHVSNTWEEGLVDCDGKGATLMLIQDQEELRFLLDSIKEKYNSFWIGLRYTLPDMNWKWINGSTLNSDVLKITDDTENDSCAAISGDKVTFESCNSDNRWICQKELYHETLSNYVGYGH

Molecular Formula

17057 (Gene_ID) P27811 (Q67-H227) (Accession)

Molecular Weight

Approximately 24-33 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Human IL2 Polyclonal Antibody
PHF36802 100 μg

Anti-Human IL2 Polyclonal Antibody

Sign In for Pricing
View Details
NCX899 100mg
A19352-100 100 mg

NCX899 100mg

Sign In for Pricing
View Details
Anti-Canine parvovirus Antibody
18939-1 200µg

Anti-Canine parvovirus Antibody

Sign In for Pricing
View Details
Tns4 siRNA Oligos set (Rat)
47270176 3x 5 nmol

Tns4 siRNA Oligos set (Rat)

Sign In for Pricing
View Details
APC_Cy7-Linked Monoclonal Antibody to Creatine Kinase, Muscle (CKM)
MBS2150749-01 0.1 mL

APC_Cy7-Linked Monoclonal Antibody to Creatine Kinase, Muscle (CKM)

Sign In for Pricing
View Details
APC_Cy7-Linked Monoclonal Antibody to Creatine Kinase, Muscle (CKM)
MBS2150749-02 0.2 mL

APC_Cy7-Linked Monoclonal Antibody to Creatine Kinase, Muscle (CKM)

Sign In for Pricing
View Details