Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Klrb1a, Mouse (HEK293, His)

The Klrb1a protein is critical for stimulating NK cell cytotoxicity and contributes to immune defense mechanisms.Klrb1a exists as a homodimer with disulfide bonds and complexly regulates NK cell activity.Klrb1a Protein, Mouse (HEK293, His) is the recombinant mouse-derived Klrb1a protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

Klrb1a Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/klrb1a-protein-mouse-hek293-his.html

Purity

95.00

Smiles

QKPSIEKCYVLIQENLNKTTDCSAKLECPQDWLSHRDKCFHVSHVSNTWEEGLVDCDGKGATLMLIQDQEELRFLLDSIKEKYNSFWIGLRYTLPDMNWKWINGSTLNSDVLKITDDTENDSCAAISGDKVTFESCNSDNRWICQKELYHETLSNYVGYGH

Molecular Formula

17057 (Gene_ID) P27811 (Q67-H227) (Accession)

Molecular Weight

Approximately 24-33 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

DYRK2 Rabbit pAb (APR27023N)
APR27023N-01 50 µL

DYRK2 Rabbit pAb (APR27023N)

Sign In for Pricing
View Details
DYRK2 Rabbit pAb (APR27023N)
APR27023N-02 100 µL

DYRK2 Rabbit pAb (APR27023N)

Sign In for Pricing
View Details
DYRK2 Rabbit pAb (APR27023N)
APR27023N-03 200 µL

DYRK2 Rabbit pAb (APR27023N)

Sign In for Pricing
View Details
ATG4A Antibody
A52079-50UL 50 μL

ATG4A Antibody

Sign In for Pricing
View Details
FUBP1 antibody
FNab03235 100 µg

FUBP1 antibody

Sign In for Pricing
View Details
Recombinant Human S100B Protein, GST, E.coli-10ug
QP13402-GST-10ug 10ug

Recombinant Human S100B Protein, GST, E.coli-10ug

Sign In for Pricing
View Details