Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Klrb1a, Mouse (HEK293, His)

The Klrb1a protein is critical for stimulating NK cell cytotoxicity and contributes to immune defense mechanisms.Klrb1a exists as a homodimer with disulfide bonds and complexly regulates NK cell activity.Klrb1a Protein, Mouse (HEK293, His) is the recombinant mouse-derived Klrb1a protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

Klrb1a Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/klrb1a-protein-mouse-hek293-his.html

Purity

95.00

Smiles

QKPSIEKCYVLIQENLNKTTDCSAKLECPQDWLSHRDKCFHVSHVSNTWEEGLVDCDGKGATLMLIQDQEELRFLLDSIKEKYNSFWIGLRYTLPDMNWKWINGSTLNSDVLKITDDTENDSCAAISGDKVTFESCNSDNRWICQKELYHETLSNYVGYGH

Molecular Formula

17057 (Gene_ID) P27811 (Q67-H227) (Accession)

Molecular Weight

Approximately 24-33 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polypyrimidine Tract Binding Protein (PTB) (MaxLight 750)
MBS6259941-01 0.1 mL

Polypyrimidine Tract Binding Protein (PTB) (MaxLight 750)

Sign In for Pricing
View Details
Polypyrimidine Tract Binding Protein (PTB) (MaxLight 750)
MBS6259941-02 5x 0.1 mL

Polypyrimidine Tract Binding Protein (PTB) (MaxLight 750)

Sign In for Pricing
View Details
ZNF207 Protein Vector (Human) (pPB-C-His)
PV047457 500 ng

ZNF207 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
CHRNA5 Antibody (Center)
MBS9208523-01 0.08 mL

CHRNA5 Antibody (Center)

Sign In for Pricing
View Details
CHRNA5 Antibody (Center)
MBS9208523-02 0.4 mL

CHRNA5 Antibody (Center)

Sign In for Pricing
View Details
CHRNA5 Antibody (Center)
MBS9208523-03 5x 0.4 mL

CHRNA5 Antibody (Center)

Sign In for Pricing
View Details