Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bombyx mori nuclear polyhedrosis virus Polyhedrin (PH)

Product Specifications

Product Name Alternative

Major occlusion protein

Abbreviation

Recombinant Bombyx mori nuclear polyhedrosis virus Polyhedrin protein

Gene Name

PH

UniProt

P03237

Expression Region

2-245aa

Organism

Bombyx mori nuclear polyhedrosis virus (BmNPV)

Target Sequence

PNYSYNPTIGRTYVYDNKYYKNLGGLIKNAKRKKHLIEHEKEEKQWDLLDNYMVAEDPFLGPGKNQKLTLFKEVRNVKPDTMKLIVNWSGKEFLRETWTRFVEDSFPIVNDQEVMDVYLVANLKPTRPNRCYKFLAQHALRWDEDYVPHEVIRIMEPSYVGMNNEYRISLAKKGGGCPIMNIHSEYTNSFESFVNRVIWENFYKPIVYIGTDSAEEEEILIEVSLVFKIKEFAPDAPLFTGPAY

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Major component of the virus occlusion bodies, which are large proteinaceous structures polyhedra, that protect the virus from the outside environment for extended periods until they are ingested by insect larvae.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

35.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Genomic DNA, Uterus
CD564167 5 µg

Tissue Genomic DNA, Uterus

Sign In for Pricing
View Details
PP1C gamma (PPP1CC) Rabbit Polyclonal Antibody
TA367202 100 µL

PP1C gamma (PPP1CC) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Crat Mouse Gene Knockout Kit (CRISPR)
KN503798 1 Kit

Crat Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Nucleolin (NCL) ELISA Kit
RDR-NCL-Mu-01 96 Tests

Mouse Nucleolin (NCL) ELISA Kit

Sign In for Pricing
View Details
Mouse Nucleolin (NCL) ELISA Kit
RDR-NCL-Mu-02 48 Tests

Mouse Nucleolin (NCL) ELISA Kit

Sign In for Pricing
View Details
TRIM66 Human Gene Knockout Kit (CRISPR)
KN427892 1 Kit

TRIM66 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details