CD30 Ligand/TNFSF8, Rat (HEK293, Fc)

QKKDSTPKTTESVPLKGGNCSEDLLCTLKRTPSKKSWAYLQVSKHLNSAKLSWNQDGTIHGLVYQDGNLVVQFPGWYFIICQLQFLVQCSNHSMDLTLQLVINSKIKKQALVTVCESGVQGKNIYHNLSQFLLHYLQVNSTISVRVDNFQYVDTNTFPLDNVLSVFLYSSSD

[1]Cerutti A, et al. CD30 is a CD40-inducible molecule that negatively regulates CD40-mediated immunoglobulin class switching in non-antigen-selected human B cells. Immunity. 1998 Aug;9 (2) :247-56.|[2]Gruss H-J, et al. CD30 ligand, a member of the TNF ligand superfamily, with growth and activation control CD30+ lymphoid and lymphoma cells. Leuk Lymphoma. 1996 Feb;20 (5-6) :397-409.|[3]Pera MF, et al. CD30 and its ligand: possible role in regulation of teratoma stem cells. APMIS. 1998 Jan;106 (1) :169-72; discussion 173.|[4]Wang X, et al. CD30L/CD30 signaling regulates the formation of the tumor immune microenvironment and inhibits intestinal tumor development of colitis-associated colon cancer in mice. Int Immunopharmacol. 2020 Jul;84:106531.|[5]Mei C, et al. CD30L+ classical monocytes play a pro-inflammatory role in the development of ulcerative colitis in patients. Mol Immunol. 2021 Oct;138:10-19.