Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDK5, Human (P.pastoris, His)

CDK5 is a proline-directed serine/threonine protein kinase that critically regulates neuronal cell cycle, differentiation and potential apoptosis in neuronal diseases by preventing cell cycle re-entry. It interacts with numerous proteins involved in neuronal development and coordinates processes such as survival, migration, differentiation, axonal growth, synaptogenesis, and neurotransmission. CDK5 Protein, Human (P.pastoris, His) is the recombinant human-derived CDK5 protein, expressed by P. pastoris , with N-His labeled tag.

Product Specifications

Product Name Alternative

CDK5 Protein, Human (P.pastoris, His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cyclin-dependent-kinase-5-cdk5-human-p-pastoris-his.html

Purity

95.00

Smiles

MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP

Molecular Formula

1020 (Gene_ID) Q00535 (M1-P292) (Accession)

Molecular Weight

Approximately 38.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BRAP Antibody
KC-14335-01 50 μL

BRAP Antibody

Sign In for Pricing
View Details
BRAP Antibody
KC-14335-02 100 µL

BRAP Antibody

Sign In for Pricing
View Details
BRAP Antibody
KC-14335-03 1 mL

BRAP Antibody

Sign In for Pricing
View Details
PATE3 (NM_001129883) Human Over-expression Lysate
LY432117 100 µg

PATE3 (NM_001129883) Human Over-expression Lysate

Sign In for Pricing
View Details
Bromo 2-Deoxy-2-N-phthalimido-3,4,6-tri-O-acetyl-a,b-D-glucopyranoside (Stabilized with ~2% CaCO3)
TRC-B683000-250MG 250 mg

Bromo 2-Deoxy-2-N-phthalimido-3,4,6-tri-O-acetyl-a,b-D-glucopyranoside (Stabilized with ~2% CaCO3)

Sign In for Pricing
View Details
Tissue FFPE Sections, Breast
CS803641 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details