Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDK5, Human (P.pastoris, His)

CDK5 is a proline-directed serine/threonine protein kinase that critically regulates neuronal cell cycle, differentiation and potential apoptosis in neuronal diseases by preventing cell cycle re-entry. It interacts with numerous proteins involved in neuronal development and coordinates processes such as survival, migration, differentiation, axonal growth, synaptogenesis, and neurotransmission. CDK5 Protein, Human (P.pastoris, His) is the recombinant human-derived CDK5 protein, expressed by P. pastoris , with N-His labeled tag.

Product Specifications

Product Name Alternative

CDK5 Protein, Human (P.pastoris, His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cyclin-dependent-kinase-5-cdk5-human-p-pastoris-his.html

Purity

95.00

Smiles

MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP

Molecular Formula

1020 (Gene_ID) Q00535 (M1-P292) (Accession)

Molecular Weight

Approximately 38.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Lung
CS806535 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
Guinea pig Nerve Growth Factor (NGF) ELISA Kit
RD-NGF-Gu-01 96 Tests

Guinea pig Nerve Growth Factor (NGF) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Nerve Growth Factor (NGF) ELISA Kit
RD-NGF-Gu-02 48 Tests

Guinea pig Nerve Growth Factor (NGF) ELISA Kit

Sign In for Pricing
View Details
SP110 Rabbit Polyclonal Antibody
TA366671 100 µL

SP110 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Liver
CS519574 5x 5 µm

Frozen Tissue Sections, Liver

Sign In for Pricing
View Details
CTLA4 Antibody (HRP)
KH-194-01 50 μL

CTLA4 Antibody (HRP)

Sign In for Pricing
View Details