Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MCP-2/CCL8, Human (HEK293, His)

MCP-2/CCL8 Protein, Human (HEK293, His) is a CC chemokine that interacts with CCR1, CCR2B, CCR3, and CCR5 to mediate host inflammatory immune responses, tumorigenesis, and antiviral infections. MCP-2/CCL8 Protein, Human (HEK293, His) is a recombinant human MCP-2/CCL8 (Q24-P99) protein expressed by HEK293 with a his tag[1][2].

Product Specifications

Product Name Alternative

MCP-2/CCL8 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mcp-2-ccl8-protein-human-hek293-his.html

Purity

98.0

Smiles

QPDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCPKEAVIFKTKRGKEVCADPKERWVRDSMKHLDQIFQNLKPHHHHHH

Molecular Formula

6355 (Gene_ID) P80075 (Q24-P99) (Accession)

Molecular Weight

Approximately 13 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Xiang Zhang, et al. CCL8 secreted by tumor-associated macrophages promotes invasion and stemness of glioblastoma cells via ERK1/2 signaling. Lab Invest. 2020 Apr;100 (4) :619-629.|[2]Jan Korbecki, et al. CC Chemokines in a Tumor: A Review of Pro-Cancer and Anti-Cancer Properties of the Ligands of Receptors CCR1, CCR2, CCR3, and CCR4. Int J Mol Sci. 2020 Nov 9;21 (21) :8412.|[3]Jian Zhou, et al. MCP2 activates NF-κB signaling pathway promoting the migration and invasion of ESCC cells. Cell Biol Int. 2018 Mar;42 (3) :365-372.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL1RAPL2 Rabbit Polyclonal Antibody (HRP)
orb470202 100 µL

IL1RAPL2 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Fzd2 (NM_020510) Mouse Tagged ORF Clone
MG208974 10 µg

Fzd2 (NM_020510) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
GPA33 Antibody (HRP)
orb351418-01 50 µg

GPA33 Antibody (HRP)

Sign In for Pricing
View Details
GPA33 Antibody (HRP)
orb351418-02 100 µg

GPA33 Antibody (HRP)

Sign In for Pricing
View Details
CAS antibody (Tyr165)
70R-31498 0.1 mg

CAS antibody (Tyr165)

Sign In for Pricing
View Details
KIF5C, CT (KIF5C, KIAA0531, NKHC2, Kinesin heavy chain isoform 5C, Kinesin heavy chain neuron-specific 2) (FITC) discontinued
037448-FITC 200 µL

KIF5C, CT (KIF5C, KIAA0531, NKHC2, Kinesin heavy chain isoform 5C, Kinesin heavy chain neuron-specific 2) (FITC) discontinued

Sign In for Pricing
View Details