Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VAMP3, Human (His)

VAMP3 protein is an important SNARE protein that promotes vesicle transport from late endosomes to the trans-Golgi network. Its interaction with BVES, mediated by its C-terminal cytoplasmic tail, is crucial in this process. VAMP3 Protein, Human (His) is the recombinant human-derived VAMP3 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

VAMP3 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vamp3-protein-human-his.html

Purity

96.00

Smiles

MSTGPTAATGSNRRLQQTQNQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNCK

Molecular Formula

9341 (Gene_ID) Q15836 (M1-K77) (Accession)

Molecular Weight

Approximately 12 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EPC1 Antibody
KC-36481-01 50 μL

EPC1 Antibody

Sign In for Pricing
View Details
EPC1 Antibody
KC-36481-02 100 µL

EPC1 Antibody

Sign In for Pricing
View Details
EPC1 Antibody
KC-36481-03 1 mL

EPC1 Antibody

Sign In for Pricing
View Details
Annexin V, CF®488A Conjugate, Azide-Free, Lyophilized
#29005R-5ug 1x 5 µg

Annexin V, CF®488A Conjugate, Azide-Free, Lyophilized

Sign In for Pricing
View Details
Thrombospondin 2 (THBS2) (NM_003247) Human Over-expression Lysate
LY418810 100 µg

Thrombospondin 2 (THBS2) (NM_003247) Human Over-expression Lysate

Sign In for Pricing
View Details
ZFP3 Human qPCR Primer Pair (NM_153018)
HP218017 200 Reactions

ZFP3 Human qPCR Primer Pair (NM_153018)

Sign In for Pricing
View Details