Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VAMP3, Human (His)

VAMP3 protein is an important SNARE protein that promotes vesicle transport from late endosomes to the trans-Golgi network. Its interaction with BVES, mediated by its C-terminal cytoplasmic tail, is crucial in this process. VAMP3 Protein, Human (His) is the recombinant human-derived VAMP3 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

VAMP3 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vamp3-protein-human-his.html

Purity

96.00

Smiles

MSTGPTAATGSNRRLQQTQNQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNCK

Molecular Formula

9341 (Gene_ID) Q15836 (M1-K77) (Accession)

Molecular Weight

Approximately 12 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dermcidin (DCD) Rabbit Polyclonal Antibody
TA365755 100 µL

Dermcidin (DCD) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Alpha Dystroglycan (DAG1) Human Gene Knockout Kit (CRISPR)
KN401121 1 Kit

Alpha Dystroglycan (DAG1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
1700034J05Rik Mouse Gene Knockout Kit (CRISPR)
KN500139 1 Kit

1700034J05Rik Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Rps24 (BC058817) Mouse Tagged ORF Clone
MG200752 10 µg

Rps24 (BC058817) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
12 Lipoxygenase (ALOX12) Human Gene Knockout Kit (CRISPR)
KN210211LP 1 Kit

12 Lipoxygenase (ALOX12) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TRIM24 Polyclonal Antibody
E-AB-17454-01 20 µL

TRIM24 Polyclonal Antibody

Sign In for Pricing
View Details