Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VAMP3, Human (His)

VAMP3 protein is an important SNARE protein that promotes vesicle transport from late endosomes to the trans-Golgi network. Its interaction with BVES, mediated by its C-terminal cytoplasmic tail, is crucial in this process. VAMP3 Protein, Human (His) is the recombinant human-derived VAMP3 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

VAMP3 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vamp3-protein-human-his.html

Purity

96.00

Smiles

MSTGPTAATGSNRRLQQTQNQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNCK

Molecular Formula

9341 (Gene_ID) Q15836 (M1-K77) (Accession)

Molecular Weight

Approximately 12 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM133A Human Gene Knockout Kit (CRISPR)
KN414870 1 Kit

FAM133A Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
3-Biphenylboronic Acid
TRC-B535228-5G 5 g

3-Biphenylboronic Acid

Sign In for Pricing
View Details
Her2 (ERBB2) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5C3]
TA505803BM 100 µL

Her2 (ERBB2) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5C3]

Sign In for Pricing
View Details
PTCD2 (NM_024754) Human Over-expression Lysate
LC403024 20 µg

PTCD2 (NM_024754) Human Over-expression Lysate

Sign In for Pricing
View Details
PE/Cyanine5.5 Anti-Mouse CD3ε Antibody[145-2C11]
E-AB-F1103I-01 50 Tests

PE/Cyanine5.5 Anti-Mouse CD3ε Antibody[145-2C11]

Sign In for Pricing
View Details
PE/Cyanine5.5 Anti-Mouse CD3ε Antibody[145-2C11]
E-AB-F1103I-02 100 Tests

PE/Cyanine5.5 Anti-Mouse CD3ε Antibody[145-2C11]

Sign In for Pricing
View Details