Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-11, Mouse

IL-11 protein is a multifunctional cytokine that stimulates the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells and induces megakaryocyte maturation to increase platelet production. It also contributes to liver cell proliferation in response to liver injury. IL-11 Protein, Mouse is the recombinant mouse-derived IL-11 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

IL-11 Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-11-protein-mouse.html

Purity

96

Smiles

PGPPAGSPRVSSDPRADLDSAVLLTRSLLADTRQLAAQMRDKFPADGDHSLDSLPTLAMSAGTLGSLQLPGVLTRLRVDLMSYLRHVQWLRRAGGPSLKTLEPELGALQARLERLLRRLQLLMSRLALPQAAPDQPVIPLGPPASAWGSIRAAHAILGGLHLTLDWAVRGLLLLKTRL

Molecular Formula

16156 (Gene_ID) P47873/NP_032376.1 (P22-L199) (Accession)

Molecular Weight

Approximately 18-20 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

WDR83 3'UTR Luciferase Stable Cell Line
TU028454 1.0 mL

WDR83 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
ADH4 Double Nickase Plasmid (h)
sc-409145-NIC 20 µg

ADH4 Double Nickase Plasmid (h)

Sign In for Pricing
View Details
Ccdc92-set siRNA/shRNA/RNAi Lentivector (Mouse)
15331094 4x 500 ng

Ccdc92-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
Fh1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K6811505 3x 1.0 µg

Fh1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Lypla2-set siRNA/shRNA/RNAi Lentivector (Mouse)
27845094 4x 500 ng

Lypla2-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
Rabbit α2-Antiplasmin, α2-AP ELISA Kit
QY-E30075 96 Tests

Rabbit α2-Antiplasmin, α2-AP ELISA Kit

Sign In for Pricing
View Details