Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-11, Mouse

IL-11 protein is a multifunctional cytokine that stimulates the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells and induces megakaryocyte maturation to increase platelet production. It also contributes to liver cell proliferation in response to liver injury. IL-11 Protein, Mouse is the recombinant mouse-derived IL-11 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

IL-11 Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-11-protein-mouse.html

Purity

96

Smiles

PGPPAGSPRVSSDPRADLDSAVLLTRSLLADTRQLAAQMRDKFPADGDHSLDSLPTLAMSAGTLGSLQLPGVLTRLRVDLMSYLRHVQWLRRAGGPSLKTLEPELGALQARLERLLRRLQLLMSRLALPQAAPDQPVIPLGPPASAWGSIRAAHAILGGLHLTLDWAVRGLLLLKTRL

Molecular Formula

16156 (Gene_ID) P47873/NP_032376.1 (P22-L199) (Accession)

Molecular Weight

Approximately 18-20 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDP1 Antibody
ABD9794 100 µg

PDP1 Antibody

Sign In for Pricing
View Details
Proteinase K Solution, 10 mg/mL
40120966-1 25 mL

Proteinase K Solution, 10 mg/mL

Sign In for Pricing
View Details
LGMN (PRSC1, Legumain, Asparaginyl Endopeptidase, Protease, Cysteine 1) (APC)
129075-APC 100 µL

LGMN (PRSC1, Legumain, Asparaginyl Endopeptidase, Protease, Cysteine 1) (APC)

Sign In for Pricing
View Details
SARS-CoV-2 Spike Recombinant protein (1000-1200 aa) His Tag
MBS8430883-01 0.05 mg

SARS-CoV-2 Spike Recombinant protein (1000-1200 aa) His Tag

Sign In for Pricing
View Details
SARS-CoV-2 Spike Recombinant protein (1000-1200 aa) His Tag
MBS8430883-02 5x 0.05 mg

SARS-CoV-2 Spike Recombinant protein (1000-1200 aa) His Tag

Sign In for Pricing
View Details
Epo-R (Phospho-Tyr368) Polyclonal Conjugated Antibody
C11996 100 µL

Epo-R (Phospho-Tyr368) Polyclonal Conjugated Antibody

Sign In for Pricing
View Details