Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-11, Mouse

IL-11 protein is a multifunctional cytokine that stimulates the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells and induces megakaryocyte maturation to increase platelet production. It also contributes to liver cell proliferation in response to liver injury. IL-11 Protein, Mouse is the recombinant mouse-derived IL-11 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

IL-11 Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-11-protein-mouse.html

Purity

96

Smiles

PGPPAGSPRVSSDPRADLDSAVLLTRSLLADTRQLAAQMRDKFPADGDHSLDSLPTLAMSAGTLGSLQLPGVLTRLRVDLMSYLRHVQWLRRAGGPSLKTLEPELGALQARLERLLRRLQLLMSRLALPQAAPDQPVIPLGPPASAWGSIRAAHAILGGLHLTLDWAVRGLLLLKTRL

Molecular Formula

16156 (Gene_ID) P47873/NP_032376.1 (P22-L199) (Accession)

Molecular Weight

Approximately 18-20 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tryptone (Casein hydrolysate, enzymatic digest)
GE6771-250g 250 g

Tryptone (Casein hydrolysate, enzymatic digest)

Sign In for Pricing
View Details
TNFAIP3 Rabbit Monoclonal Antibody
E56G4396 100 µL

TNFAIP3 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
RELA ELISA Kit (Mouse)
OKEH05793-96W 96 Well

RELA ELISA Kit (Mouse)

Sign In for Pricing
View Details
RNASE1 Rabbit Polyclonal Antibody (FITC)
orb2582478 100 µg

RNASE1 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Rat granulocyte specific antinuclear antibody (GS-ANA) ELISA Kit
MBS260251-01 48 Well

Rat granulocyte specific antinuclear antibody (GS-ANA) ELISA Kit

Sign In for Pricing
View Details
Rat granulocyte specific antinuclear antibody (GS-ANA) ELISA Kit
MBS260251-02 96 Well

Rat granulocyte specific antinuclear antibody (GS-ANA) ELISA Kit

Sign In for Pricing
View Details