Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human GDP-L-fucose synthase (GFUS)

Product Specifications

Product Name Alternative

(GDP-4-keto-6-deoxy-D-mannose-3,5-epimerase-4-reductase) (Protein FX) (Red cell NADP (H) -binding protein) (Short-chain dehydrogenase/reductase family 4E member 1)

Abbreviation

Recombinant Human GFUS protein

Gene Name

GFUS

UniProt

Q13630

Expression Region

1-321aa

Organism

Homo sapiens (Human)

Target Sequence

MGEPQGSMRILVTGGSGLVGKAIQKVVADGAGLPGEDWVFVSSKDADLTDTAQTRALFEKVQPTHVIHLAAMVGGLFRNIKYNLDFWRKNVHMNDNVLHSAFEVGARKVVSCLSTCIFPDKTTYPIDETMIHNGPPHNSNFGYSYAKRMIDVQNRAYFQQYGCTFTAVIPTNVFGPHDNFNIEDGHVLPGLIHKVHLAKSSGSALTVWGTGNPRRQFIYSLDLAQLFIWVLREYNEVEPIILSVGEEDEVSIKEAAEAVVEAMDFHGEVTFDTTKSDGQFKKTASNSKLRTYLPDFRFTPFKQAVKETCAWFTDNYEQARK

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Catalyzes the two-step NADP-dependent conversion of GDP-4-dehydro-6-deoxy-D-mannose to GDP-fucose, involving an epimerase and a reductase reaction.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

40.0 kDa

References & Citations

"Synthesis of GDP-L-fucose by the human FX protein." Tonetti M., Sturla L., Bisso A., Benatti U., De Flora A. J. Biol. Chem. 271:27274-27279 (1996)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant SARS-CoV2 S-Protein ACE2 Binding Domain
32-190041-50 50 µg

Recombinant SARS-CoV2 S-Protein ACE2 Binding Domain

Sign In for Pricing
View Details
Recombinant Pectobacterium carotovorum subsp. carotovorum Putative Holliday junction resolvase (PC1_3713)
MBS1052991-01 0.02 mg (E-Coli)

Recombinant Pectobacterium carotovorum subsp. carotovorum Putative Holliday junction resolvase (PC1_3713)

Sign In for Pricing
View Details
Recombinant Pectobacterium carotovorum subsp. carotovorum Putative Holliday junction resolvase (PC1_3713)
MBS1052991-02 0.1 mg (E-Coli)

Recombinant Pectobacterium carotovorum subsp. carotovorum Putative Holliday junction resolvase (PC1_3713)

Sign In for Pricing
View Details
Recombinant Pectobacterium carotovorum subsp. carotovorum Putative Holliday junction resolvase (PC1_3713)
MBS1052991-03 0.02 mg (Yeast)

Recombinant Pectobacterium carotovorum subsp. carotovorum Putative Holliday junction resolvase (PC1_3713)

Sign In for Pricing
View Details
Recombinant Pectobacterium carotovorum subsp. carotovorum Putative Holliday junction resolvase (PC1_3713)
MBS1052991-04 0.1 mg (Yeast)

Recombinant Pectobacterium carotovorum subsp. carotovorum Putative Holliday junction resolvase (PC1_3713)

Sign In for Pricing
View Details
Recombinant Pectobacterium carotovorum subsp. carotovorum Putative Holliday junction resolvase (PC1_3713)
MBS1052991-05 0.02 mg (Baculovirus)

Recombinant Pectobacterium carotovorum subsp. carotovorum Putative Holliday junction resolvase (PC1_3713)

Sign In for Pricing
View Details