Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human GDP-L-fucose synthase (GFUS)

Product Specifications

Product Name Alternative

(GDP-4-keto-6-deoxy-D-mannose-3,5-epimerase-4-reductase) (Protein FX) (Red cell NADP (H) -binding protein) (Short-chain dehydrogenase/reductase family 4E member 1)

Abbreviation

Recombinant Human GFUS protein

Gene Name

GFUS

UniProt

Q13630

Expression Region

1-321aa

Organism

Homo sapiens (Human)

Target Sequence

MGEPQGSMRILVTGGSGLVGKAIQKVVADGAGLPGEDWVFVSSKDADLTDTAQTRALFEKVQPTHVIHLAAMVGGLFRNIKYNLDFWRKNVHMNDNVLHSAFEVGARKVVSCLSTCIFPDKTTYPIDETMIHNGPPHNSNFGYSYAKRMIDVQNRAYFQQYGCTFTAVIPTNVFGPHDNFNIEDGHVLPGLIHKVHLAKSSGSALTVWGTGNPRRQFIYSLDLAQLFIWVLREYNEVEPIILSVGEEDEVSIKEAAEAVVEAMDFHGEVTFDTTKSDGQFKKTASNSKLRTYLPDFRFTPFKQAVKETCAWFTDNYEQARK

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Catalyzes the two-step NADP-dependent conversion of GDP-4-dehydro-6-deoxy-D-mannose to GDP-fucose, involving an epimerase and a reductase reaction.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

40.0 kDa

References & Citations

"Synthesis of GDP-L-fucose by the human FX protein." Tonetti M., Sturla L., Bisso A., Benatti U., De Flora A. J. Biol. Chem. 271:27274-27279 (1996)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Coa3 (NM_001109047) Rat Tagged Lenti ORF Clone
RR206632L4 10 µg

Coa3 (NM_001109047) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
GRB14 Protein (N-His, Human)
P504344 100 µg

GRB14 Protein (N-His, Human)

Sign In for Pricing
View Details
Duck Phosphatidylinositol-4-Phosphate 5-Kinase Type-1 Beta (PIP5K1B) ELISA Kit
MBS9393702 Inquire

Duck Phosphatidylinositol-4-Phosphate 5-Kinase Type-1 Beta (PIP5K1B) ELISA Kit

Sign In for Pricing
View Details
Anti-MAP3K1 Polyclonal Antibody
PHG45301 100 μg

Anti-MAP3K1 Polyclonal Antibody

Sign In for Pricing
View Details
Phospho-MARK4 (Ser423) Polyclonal Antibody, APC-Cy5.5 Conjugated
bs-4660R-APC-Cy5.5 100 µL

Phospho-MARK4 (Ser423) Polyclonal Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details
F12 Antibody, FITC conjugated
A21074-100UG 100 µg

F12 Antibody, FITC conjugated

Sign In for Pricing
View Details