Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human C-X-C motif chemokine 3 protein (CXCL3) (Active)

Product Specifications

Product Name Alternative

GRO-gamma, Growth-regulated protein gamma, GRO-gamma, Macrophage inflammatory protein 2-beta, MIP2-beta

Abbreviation

Recombinant Human CXCL3 protein (Active)

Gene Name

CXCL3

UniProt

P19876

Expression Region

35-107aa

Organism

Homo sapiens (Human)

Target Sequence

ASVVTELRCQCLQTLQGIHLKNIQSVNVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN

Tag

Tag-Free

Type

Active Protein & In Stock Protein

Source

E.Coli

Field of Research

Immunology

Relevance

Ligand for CXCR2 (By similarity) . Has chemotactic activity for neutrophils. May play a role in inflammation and exert its effects on endothelial cells in an autocrine fashion. In vitro, the processed form GRO-gamma (5-73) shows a fivefold higher chemotactic activity for neutrophilic granulocytes. {ECO:0000250, ECO:0000269|PubMed:10095777}.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

>97% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human CXCR2 transfected human 293 cells is in a concentration range of 10-100 ng/ml.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 µm filtered PBS, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Ligand for CXCR2 (By similarity) . Has chemotactic activity for neutrophils. May play a role in inflammation and exert its effects on endothelial cells in an autocrine fashion. In vitro, the processed form GRO-gamma (5-73) shows a fivefold higher chemotactic activity for neutrophilic granulocytes.

Molecular Weight

7.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IgG Immunoglobulin (IG266), CF405S conjugate, 0.1mg/mL
BNC040266-500 1x 500 µL

Human IgG Immunoglobulin (IG266), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP60 (LK1), CF740 conjugate, 0.1mg/mL
BNC740851-500 1x 500 µL

HSP60 (LK1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD104 (UM-A9), CF647 conjugate, 0.1mg/mL
BNC470449-500 1x 500 µL

CD104 (UM-A9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF488A conjugate, 0.1mg/mL
BNC881037-100 1x 100 µL

CD44 Standard (DF1485), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11 + PD7/26), CF770 conjugate, 0.1mg/mL
BNC700745-100 1x 100 µL

CD45 / LCA (2B11 + PD7/26), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (186-2G9), CF594 conjugate, 0.1mg/mL
BNC940178-100 1x 100 µL

CD50 (ICAM-3) (186-2G9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details