Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HNRNPA2B1, Mouse (His-SUMO, Myc)

The HNRNPA2B1 protein is an important heterogeneous nuclear ribonucleoprotein (hnRNP) that plays a key role in RNA processing and transport. It forms hnRNP particles that compact and stabilize transcripts to influence various cellular functions, including transcription, mRNA processing, nuclear export, localization, translation, and mRNA stability. HNRNPA2B1 Protein, Mouse (His-SUMO) is the recombinant mouse-derived HNRNPA2B1 protein, expressed by E. coli , with N-10*His, N-SUMO, C-Myc labeled tag.

Product Specifications

Product Name Alternative

HNRNPA2B1 Protein, Mouse (His-SUMO, Myc), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hnrnpa2b1-protein-mouse-his-sumo.html

Purity

90.0

Smiles

MEKTLETVPLERKKREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQEVQSSRSGRGGNFGFGDSRGGGGNFGPGPGSNFRGGSDGYGSGRGFGDGYNGYGGGPGGGNFGGSPGYGGGRGGYGGGGPGYGNQGGGYGGGYDNYGGGNYGSGSYNDFGNYNQQPSNYGPMKSGNFGGSRNMGGPYGGGNYGPGGSGGSGGYGGRSRY

Molecular Formula

53379 (Gene_ID) O88569 (M1-Y353) (Accession)

Molecular Weight

Approximately 57.4 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD34 (ICO-115), CF640R conjugate, 0.1mg/mL
BNC400039-500 1x 500 µL

CD34 (ICO-115), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, HMW (AE-3), CF594 conjugate, 0.1mg/mL
BNC940257-500 1x 500 µL

Cytokeratin, HMW (AE-3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P34 / cdk1 (POH-1), CF647 conjugate, 0.1mg/mL
BNC470853-500 1x 500 µL

P34 / cdk1 (POH-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PD-L1 / PDCD1LG1 / CD274 / B7-H1 (Cancer Immunotherapy Target) (PDL1/2746), CF405S conjugate, 0.1mg/mL
BNC042746-100 1x 100 µL

PD-L1 / PDCD1LG1 / CD274 / B7-H1 (Cancer Immunotherapy Target) (PDL1/2746), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/468), CF568 conjugate, 0.1mg/mL
BNC680468-100 1x 100 µL

CD8 (C8/468), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (84-3C1), Biotin conjugate, 0.1mg/mL
BNCB0342-100 1x 100 µL

CD43 (84-3C1), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details