Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cytoglobin/Histoglobin, Human (His)

Cytoglobin/Histoglobin Protein plays a vital role in protecting cells from oxidative stress, potentially acting as a safeguard against cellular damage. Additionally, it participates in intracellular processes related to oxygen storage or transfer. The protein's structural integrity involves the formation of homodimers linked by disulfide linkages, emphasizing its capacity for molecular interactions and stability within the cellular environment. Cytoglobin/Histoglobin Protein, Human (His) is the recombinant human-derived Cytoglobin/Histoglobin protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Cytoglobin/Histoglobin Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cytoglobin-histoglobin-protein-human-his.html

Smiles

MEKVPGEMEIERRERSEELSEAERKAVQAMWARLYANCEDVGVAILVRFFVNFPSAKQYFSQFKHMEDPLEMERSPQLRKHACRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHKVEPVYFKILSGVILEVVAEEFASDFPPETQRAWAKLRGLIYSHVTAAYKEVGWVQQVPNATTPPATLPSSGP

Molecular Formula

114757 (Gene_ID) Q8WWM9 (M1-P190) (Accession)

Molecular Weight

Approximately 22 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

HFE (Hereditary Hemochromatosis Protein, HFE1, HLAH, HLA-H, HH, MGC103790, MVCD7) (PE)
MBS6381055-01 0.1 mL

HFE (Hereditary Hemochromatosis Protein, HFE1, HLAH, HLA-H, HH, MGC103790, MVCD7) (PE)

Ask
View Details
HFE (Hereditary Hemochromatosis Protein, HFE1, HLAH, HLA-H, HH, MGC103790, MVCD7) (PE)
MBS6381055-02 5x 0.1 mL

HFE (Hereditary Hemochromatosis Protein, HFE1, HLAH, HLA-H, HH, MGC103790, MVCD7) (PE)

Ask
View Details
Mouse Slc7a10 Pre-designed siRNA Set A
SI113304A 1 Each

Mouse Slc7a10 Pre-designed siRNA Set A

Ask
View Details
Rabbit Monoclonal SATB2 Antibody (SATB2/8292R) - Azide and BSA Free
NBP3-24251 100 µg

Rabbit Monoclonal SATB2 Antibody (SATB2/8292R) - Azide and BSA Free

Ask
View Details
Mitofusin 1 (MFN1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3C5]
TA802216AM 100 µL

Mitofusin 1 (MFN1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3C5]

Ask
View Details
Rab3gap1 (NM_178690) Mouse Tagged ORF Clone
MR211377 10 µg

Rab3gap1 (NM_178690) Mouse Tagged ORF Clone

Ask
View Details