Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cytoglobin/Histoglobin, Human (His)

Cytoglobin/Histoglobin Protein plays a vital role in protecting cells from oxidative stress, potentially acting as a safeguard against cellular damage. Additionally, it participates in intracellular processes related to oxygen storage or transfer. The protein's structural integrity involves the formation of homodimers linked by disulfide linkages, emphasizing its capacity for molecular interactions and stability within the cellular environment. Cytoglobin/Histoglobin Protein, Human (His) is the recombinant human-derived Cytoglobin/Histoglobin protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Cytoglobin/Histoglobin Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cytoglobin-histoglobin-protein-human-his.html

Smiles

MEKVPGEMEIERRERSEELSEAERKAVQAMWARLYANCEDVGVAILVRFFVNFPSAKQYFSQFKHMEDPLEMERSPQLRKHACRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHKVEPVYFKILSGVILEVVAEEFASDFPPETQRAWAKLRGLIYSHVTAAYKEVGWVQQVPNATTPPATLPSSGP

Molecular Formula

114757 (Gene_ID) Q8WWM9 (M1-P190) (Accession)

Molecular Weight

Approximately 22 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Tex33 (NM_028522) Mouse Untagged Clone
MC211417 10 µg

Tex33 (NM_028522) Mouse Untagged Clone

Ask
View Details
Tmem97 (NM_133706) Mouse Tagged ORF Clone Lentiviral Particle
MR201535L3V 200 µL

Tmem97 (NM_133706) Mouse Tagged ORF Clone Lentiviral Particle

Ask
View Details
Mouse Monoclonal Cadherin-17 Antibody (rCDH17/8514) [Janelia Fluor 585]
NBP3-20889JF585 0.1 mL

Mouse Monoclonal Cadherin-17 Antibody (rCDH17/8514) [Janelia Fluor 585]

Ask
View Details
pU6-Keap1-sgRNA2-Cas9 Plasmid
PVT46808 2 µg

pU6-Keap1-sgRNA2-Cas9 Plasmid

Ask
View Details
DRAM (DRAM1) (NM_018370) Human Untagged Clone
SC321673 10 µg

DRAM (DRAM1) (NM_018370) Human Untagged Clone

Ask
View Details
Mouse BAD shRNA Plasmid
abx969313-01 150 µg

Mouse BAD shRNA Plasmid

Ask
View Details