Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cytoglobin/Histoglobin, Human (His)

Cytoglobin/Histoglobin Protein plays a vital role in protecting cells from oxidative stress, potentially acting as a safeguard against cellular damage. Additionally, it participates in intracellular processes related to oxygen storage or transfer. The protein's structural integrity involves the formation of homodimers linked by disulfide linkages, emphasizing its capacity for molecular interactions and stability within the cellular environment. Cytoglobin/Histoglobin Protein, Human (His) is the recombinant human-derived Cytoglobin/Histoglobin protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Cytoglobin/Histoglobin Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cytoglobin-histoglobin-protein-human-his.html

Smiles

MEKVPGEMEIERRERSEELSEAERKAVQAMWARLYANCEDVGVAILVRFFVNFPSAKQYFSQFKHMEDPLEMERSPQLRKHACRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHKVEPVYFKILSGVILEVVAEEFASDFPPETQRAWAKLRGLIYSHVTAAYKEVGWVQQVPNATTPPATLPSSGP

Molecular Formula

114757 (Gene_ID) Q8WWM9 (M1-P190) (Accession)

Molecular Weight

Approximately 22 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Human CCL2
RPF11016-01 50 µg

Recombinant Human CCL2

Ask
View Details
Recombinant Human CCL2
RPF11016-02 200 µg

Recombinant Human CCL2

Ask
View Details
Recombinant Human CCL2
RPF11016-03 1 mg

Recombinant Human CCL2

Ask
View Details
Recombinant Human Ketohexokinase Protein, GST, E.coli-500ug
QP6260-ec-500ug 500ug

Recombinant Human Ketohexokinase Protein, GST, E.coli-500ug

Ask
View Details
GOT2 (Glutamate Oxaloacetate Transaminase 2, Aspartate Aminotransferase Mitochondrial, Fatty Acid-binding Protein, FABP-1, FLJ40994, KAT4, KATIV, mAspAT, mitAAT, Plasma Membrane-associated Fatty Acid-binding Protein, FABPpm, Transaminase A)
G7122-01F 100 µg

GOT2 (Glutamate Oxaloacetate Transaminase 2, Aspartate Aminotransferase Mitochondrial, Fatty Acid-binding Protein, FABP-1, FLJ40994, KAT4, KATIV, mAspAT, mitAAT, Plasma Membrane-associated Fatty Acid-binding Protein, FABPpm, Transaminase A)

Ask
View Details
Pig C-X-C Motif Chemokine 11 / I-TAC (CXCL11) ELISA Kit
abx353408-01 96 Tests

Pig C-X-C Motif Chemokine 11 / I-TAC (CXCL11) ELISA Kit

Ask
View Details