Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human G-protein coupled receptor 182 (GPR182)

Product Specifications

Abbreviation

Recombinant Human GPR182 protein

Gene Name

GPR182

UniProt

O15218

Expression Region

1-404aa

Organism

Homo sapiens (Human)

Target Sequence

MSVKPSWGPGPSEGVTAVPTSDLGEIHNWTELLDLFNHTLSECHVELSQSTKRVVLFALYLAMFVVGLVENLLVICVNWRGSGRAGLMNLYILNMAIADLGIVLSLPVWMLEVTLDYTWLWGSFSCRFTHYFYFVNMYSSIFFLVCLSVDRYVTLTSASPSWQRYQHRVRRAMCAGIWVLSAIIPLPEVVHIQLVEGPEPMCLFMAPFETYSTWALAVALSTTILGFLLPFPLITVFNVLTACRLRQPGQPKSRRHCLLLCAYVAVFVMCWLPYHVTLLLLTLHGTHISLHCHLVHLLYFFYDVIDCFSMLHCVINPILYNFLSPHFRGRLLNAVVHYLPKDQTKAGTCASSSSCSTQHSIIITKGDSQPAAAAPHPEPSLSFQAHHLLPNTSPISPTQPLTPS

Tag

N-terminal 10xHis-tagged

Type

CF Transmembrane Protein & In Stock Protein

Source

In vitro E.coli expression system

Field of Research

Cancer

Relevance

Orphan receptor.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

46.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUC2 (CCP58), CF568 conjugate, 0.1mg/mL
BNC680032-500 1x 500 µL

MUC2 (CCP58), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-7C10), CF740 conjugate, 0.1mg/mL
BNC740009-500 1x 500 µL

MART-1 / Melan-A (M2-7C10), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (UCHL-1), CF568 conjugate, 0.1mg/mL
BNC680003-100 1x 100 µL

CD45RO (UCHL-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD4 (EDU-2), CF594 conjugate, 0.1mg/mL
BNC940345-100 1x 100 µL

CD4 (EDU-2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF647 conjugate, 0.1mg/mL
BNC471429-500 1x 500 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD100 (Semaphorin-4D) (A8), CF594 conjugate, 0.1mg/mL
BNC940218-100 1x 100 µL

CD100 (Semaphorin-4D) (A8), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details